Mercurial > repos > pimarin > bakta
view test-data/tmp/TEST_1.gbff @ 5:44fb905481f0 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/blob/master/tools/bakta commit a7dcdae8bccb5a8d7abdb9c6d058f9bd7c6f6c15
| author | pimarin |
|---|---|
| date | Thu, 12 Jan 2023 11:25:17 +0000 |
| parents | eea334d9988b |
| children |
line wrap: on
line source
<<<<<<< HEAD:tools/bakta/test-data/TEST_1/TEST_1.gbff LOCUS contig_1 1330 bp DNA circular BCT 19-DEC-2022 ======= <<<<<<< HEAD:tools/bakta/test-data/TEST_4/TEST_4.gbff LOCUS p2 1330 bp DNA circular BCT 16-SEP-2022 DEFINITION plasmid pOSAK1, complete sequence. ACCESSION p2 VERSION p2 ======= LOCUS contig_1 1330 bp DNA circular BCT 21-DEC-2022 >>>>>>> 17d4de2b8 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff DEFINITION plasmid unnamed1, complete sequence. ACCESSION contig_1 VERSION contig_1 >>>>>>> f1bb03fb2 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff KEYWORDS . SOURCE None ORGANISM . . COMMENT Annotated with Bakta Software: v1.6.1 Database: v4.0 DOI: 10.1099/mgen.0.000685 URL: github.com/oschwengers/bakta ##Genome Annotation Summary:## <<<<<<< HEAD:tools/bakta/test-data/tmp/TEST_1.gbff <<<<<<< HEAD:tools/bakta/test-data/TEST_1/TEST_1.gbff Annotation Date :: 12/19/2022, 10:20:25 ======= <<<<<<< HEAD:tools/bakta/test-data/TEST_4/TEST_4.gbff Annotation Date :: 09/16/2022, 07:32:50 ======= Annotation Date :: 12/21/2022, 14:34:39 >>>>>>> f1bb03fb2 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff >>>>>>> 17d4de2b8 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff ======= Annotation Date :: 12/21/2022, 19:53:31 >>>>>>> 195c8410c (change option for plot):tools/bakta/test-data/TEST_1/TEST_1.gbff Annotation Pipeline :: Bakta Annotation Software version :: v1.6.1 Annotation Database version :: v4.0 CDSs :: 2 tRNAs :: 0 tmRNAs :: 0 rRNAs :: 0 ncRNAs :: 0 regulatory ncRNAs :: 0 CRISPR Arrays :: 0 oriCs/oriVs :: 0 oriTs :: 0 gaps :: 0 pseudogenes :: 0 FEATURES Location/Qualifiers source 1..1330 /mol_type="genomic DNA" /plasmid="unnamed1" gene 413..736 /locus_tag="IHHALP_00005" CDS 413..736 /product="hypothetical protein" /locus_tag="IHHALP_00005" /protein_id="gnl|Bakta|IHHALP_00005" /translation="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA AALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLSRL MAD" /codon_start=1 /transl_table=11 /inference="ab initio prediction:Prodigal:2.6" gene complement(join(971..1330,1..141)) /locus_tag="IHHALP_00010" CDS complement(join(971..1330,1..141)) /product="hypothetical protein" /locus_tag="IHHALP_00010" /protein_id="gnl|Bakta|IHHALP_00010" /translation="MNKQQQTALNMAGFIKSQSLTLLEKLDALDADEQATMCEKLHELA EEQIEAIKNKDKTLFIVYATDIYSPSEFFSKIESDLKKKKSKGDVFFDLIIPNGGKKDR YVYTSFNGEKFSSYTLNKVTKTDEYNDLSELSASFFKKNFDKINVNLLSKATSFALKKG IPI" /codon_start=1 /transl_table=11 /inference="ab initio prediction:Prodigal:2.6" ORIGIN 1 ttcttctgcg agttcgtgca gcttctcaca catggtggcc tgctcgtcag catcgagtgc 61 gtccagtttt tcgagcagcg tcaggctctg gctttttatg aatcccgcca tgttgagtgc 121 agtttgctgc tgcttgttca tctttctgtt ttctccgttc tgtctgtcat ctgcgtcgtg 181 tgattatatc gcgcaccact tttcgaccgt cttaccgccg gtattctgcc gacggacatt 241 tcagtcagac aacactgtca ctgccaaaaa acagcagtgc tttgttggta attcgaactt 301 gcagacagga caggatgtgc aattgttata ccgcgcatac atgcacgcta ttacaattac 361 cctggtcagg gcttcgcccc gacaccccat gtcagatacg gagccatgtt ttatgacaaa 421 acgaagtgga agtaatacgc gcaggcgggc tatcagtcgc cctgttcgtc tgacggcaga 481 agaagaccag gaaatcagaa aaagggctgc tgaatgcggc aagaccgttt ctggtttttt 541 acgggcggca gctctcggta agaaagttaa ctcactgact gatgaccggg tgctgaaaga 601 agttatgcga ctgggggcgt tgcagaaaaa actctttatc gacggcaagc gtgtcgggga 661 cagagagtat gcggaggtgc tgatcgctat tacggagtat caccgtgccc tgttatccag 721 gcttatggca gattagcttc ccggagagaa actgtcgaaa acagacggta tgaacgccgt 781 aagcccccaa accgatcgcc attcactttc atgcatagct atgcagtgag ctgaaagcga 841 tcctgacgca tttttccggt ttaccccggg gaaaacatct ctttttgcgg tgtctgcgtc 901 agaatcgcgt tcagcgcgtt ttggcggtgc gcgtaatgag acgttatggt aaatgtcttc 961 tggcttgata ttatattgga atgccttttt tcaaagcaaa tgatgtggct ttggatagaa 1021 ggtttacgtt gatcttatca aagttttttt taaagaacga agccgagagc tcagataaat 1081 cattatattc atcagttttc gtaactttgt ttaatgtgta acttgaaaac ttctcgccat 1141 taaatgacgt atagacgtaa cgatcttttt ttccaccgtt aggaattatt aaatcaaaaa 1201 aaacatcacc cttgcttttc tttttcttca agtcggattc gatttttgag aaaaattcgc 1261 tcgggctata aatatcagta gcatagacaa taaataaagt tttatcttta ttttttattg 1321 cttctatttg //
