Mercurial > repos > pimarin > bakta
comparison test-data/tmp/TEST_1.gbff @ 3:eea334d9988b draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/blob/master/tools/bakta commit 73af464cc860250c3fa3dd433602283ab5a44f53-dirty
| author | pimarin |
|---|---|
| date | Thu, 22 Dec 2022 15:01:43 +0000 |
| parents | |
| children |
comparison
equal
deleted
inserted
replaced
| 2:ca9e2125c5de | 3:eea334d9988b |
|---|---|
| 1 <<<<<<< HEAD:tools/bakta/test-data/TEST_1/TEST_1.gbff | |
| 2 LOCUS contig_1 1330 bp DNA circular BCT 19-DEC-2022 | |
| 3 ======= | |
| 4 <<<<<<< HEAD:tools/bakta/test-data/TEST_4/TEST_4.gbff | |
| 5 LOCUS p2 1330 bp DNA circular BCT 16-SEP-2022 | |
| 6 DEFINITION plasmid pOSAK1, complete sequence. | |
| 7 ACCESSION p2 | |
| 8 VERSION p2 | |
| 9 ======= | |
| 10 LOCUS contig_1 1330 bp DNA circular BCT 21-DEC-2022 | |
| 11 >>>>>>> 17d4de2b8 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff | |
| 12 DEFINITION plasmid unnamed1, complete sequence. | |
| 13 ACCESSION contig_1 | |
| 14 VERSION contig_1 | |
| 15 >>>>>>> f1bb03fb2 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff | |
| 16 KEYWORDS . | |
| 17 SOURCE None | |
| 18 ORGANISM . | |
| 19 . | |
| 20 COMMENT Annotated with Bakta | |
| 21 Software: v1.6.1 | |
| 22 Database: v4.0 | |
| 23 DOI: 10.1099/mgen.0.000685 | |
| 24 URL: github.com/oschwengers/bakta | |
| 25 | |
| 26 ##Genome Annotation Summary:## | |
| 27 <<<<<<< HEAD:tools/bakta/test-data/tmp/TEST_1.gbff | |
| 28 <<<<<<< HEAD:tools/bakta/test-data/TEST_1/TEST_1.gbff | |
| 29 Annotation Date :: 12/19/2022, 10:20:25 | |
| 30 ======= | |
| 31 <<<<<<< HEAD:tools/bakta/test-data/TEST_4/TEST_4.gbff | |
| 32 Annotation Date :: 09/16/2022, 07:32:50 | |
| 33 ======= | |
| 34 Annotation Date :: 12/21/2022, 14:34:39 | |
| 35 >>>>>>> f1bb03fb2 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff | |
| 36 >>>>>>> 17d4de2b8 (update bakta for plot output and to reduce number of output files):tools/bakta/test-data/tmp/TEST_1.gbff | |
| 37 ======= | |
| 38 Annotation Date :: 12/21/2022, 19:53:31 | |
| 39 >>>>>>> 195c8410c (change option for plot):tools/bakta/test-data/TEST_1/TEST_1.gbff | |
| 40 Annotation Pipeline :: Bakta | |
| 41 Annotation Software version :: v1.6.1 | |
| 42 Annotation Database version :: v4.0 | |
| 43 CDSs :: 2 | |
| 44 tRNAs :: 0 | |
| 45 tmRNAs :: 0 | |
| 46 rRNAs :: 0 | |
| 47 ncRNAs :: 0 | |
| 48 regulatory ncRNAs :: 0 | |
| 49 CRISPR Arrays :: 0 | |
| 50 oriCs/oriVs :: 0 | |
| 51 oriTs :: 0 | |
| 52 gaps :: 0 | |
| 53 pseudogenes :: 0 | |
| 54 FEATURES Location/Qualifiers | |
| 55 source 1..1330 | |
| 56 /mol_type="genomic DNA" | |
| 57 /plasmid="unnamed1" | |
| 58 gene 413..736 | |
| 59 /locus_tag="IHHALP_00005" | |
| 60 CDS 413..736 | |
| 61 /product="hypothetical protein" | |
| 62 /locus_tag="IHHALP_00005" | |
| 63 /protein_id="gnl|Bakta|IHHALP_00005" | |
| 64 /translation="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA | |
| 65 AALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLSRL | |
| 66 MAD" | |
| 67 /codon_start=1 | |
| 68 /transl_table=11 | |
| 69 /inference="ab initio prediction:Prodigal:2.6" | |
| 70 gene complement(join(971..1330,1..141)) | |
| 71 /locus_tag="IHHALP_00010" | |
| 72 CDS complement(join(971..1330,1..141)) | |
| 73 /product="hypothetical protein" | |
| 74 /locus_tag="IHHALP_00010" | |
| 75 /protein_id="gnl|Bakta|IHHALP_00010" | |
| 76 /translation="MNKQQQTALNMAGFIKSQSLTLLEKLDALDADEQATMCEKLHELA | |
| 77 EEQIEAIKNKDKTLFIVYATDIYSPSEFFSKIESDLKKKKSKGDVFFDLIIPNGGKKDR | |
| 78 YVYTSFNGEKFSSYTLNKVTKTDEYNDLSELSASFFKKNFDKINVNLLSKATSFALKKG | |
| 79 IPI" | |
| 80 /codon_start=1 | |
| 81 /transl_table=11 | |
| 82 /inference="ab initio prediction:Prodigal:2.6" | |
| 83 ORIGIN | |
| 84 1 ttcttctgcg agttcgtgca gcttctcaca catggtggcc tgctcgtcag catcgagtgc | |
| 85 61 gtccagtttt tcgagcagcg tcaggctctg gctttttatg aatcccgcca tgttgagtgc | |
| 86 121 agtttgctgc tgcttgttca tctttctgtt ttctccgttc tgtctgtcat ctgcgtcgtg | |
| 87 181 tgattatatc gcgcaccact tttcgaccgt cttaccgccg gtattctgcc gacggacatt | |
| 88 241 tcagtcagac aacactgtca ctgccaaaaa acagcagtgc tttgttggta attcgaactt | |
| 89 301 gcagacagga caggatgtgc aattgttata ccgcgcatac atgcacgcta ttacaattac | |
| 90 361 cctggtcagg gcttcgcccc gacaccccat gtcagatacg gagccatgtt ttatgacaaa | |
| 91 421 acgaagtgga agtaatacgc gcaggcgggc tatcagtcgc cctgttcgtc tgacggcaga | |
| 92 481 agaagaccag gaaatcagaa aaagggctgc tgaatgcggc aagaccgttt ctggtttttt | |
| 93 541 acgggcggca gctctcggta agaaagttaa ctcactgact gatgaccggg tgctgaaaga | |
| 94 601 agttatgcga ctgggggcgt tgcagaaaaa actctttatc gacggcaagc gtgtcgggga | |
| 95 661 cagagagtat gcggaggtgc tgatcgctat tacggagtat caccgtgccc tgttatccag | |
| 96 721 gcttatggca gattagcttc ccggagagaa actgtcgaaa acagacggta tgaacgccgt | |
| 97 781 aagcccccaa accgatcgcc attcactttc atgcatagct atgcagtgag ctgaaagcga | |
| 98 841 tcctgacgca tttttccggt ttaccccggg gaaaacatct ctttttgcgg tgtctgcgtc | |
| 99 901 agaatcgcgt tcagcgcgtt ttggcggtgc gcgtaatgag acgttatggt aaatgtcttc | |
| 100 961 tggcttgata ttatattgga atgccttttt tcaaagcaaa tgatgtggct ttggatagaa | |
| 101 1021 ggtttacgtt gatcttatca aagttttttt taaagaacga agccgagagc tcagataaat | |
| 102 1081 cattatattc atcagttttc gtaactttgt ttaatgtgta acttgaaaac ttctcgccat | |
| 103 1141 taaatgacgt atagacgtaa cgatcttttt ttccaccgtt aggaattatt aaatcaaaaa | |
| 104 1201 aaacatcacc cttgcttttc tttttcttca agtcggattc gatttttgag aaaaattcgc | |
| 105 1261 tcgggctata aatatcagta gcatagacaa taaataaagt tttatcttta ttttttattg | |
| 106 1321 cttctatttg | |
| 107 // |