Mercurial > repos > dcorreia > phylogeny_tools
changeset 54:4de4162bb349 draft
planemo upload commit e0ca504b3313992020acf8ab7aed0a261237766e-dirty
| author | dcorreia |
|---|---|
| date | Thu, 26 Jan 2017 10:05:45 -0500 |
| parents | 58bc59db1bf7 |
| children | a4d65d03b993 |
| files | clustalo/clustalo.xml clustalo/test-data/seqtest.fasta clustalo/test-data/seqtest_aln.fasta clustalo/test-data/seqtest_aln2.fasta muscle/muscle.xml muscle/test-data/seqtest.fasta muscle/test-data/seqtest_aln.fasta phyml_oneclick/phyml_3_0_oneclick.xml phyml_oneclick/phyml_3_1_oneclick.xml phyml_oneclick/phyml_oneclick.xml repository_dependencies.xml tool_dependencies.xml |
| diffstat | 12 files changed, 700 insertions(+), 889 deletions(-) [+] |
line wrap: on
line diff
--- a/clustalo/clustalo.xml Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,220 +0,0 @@ -<tool id="clustalo" name="Clustal Omega" version="1.2.1.1"> - <description>Multiple sequence alignment software</description> - <edam_operations> - <edam_operation>operation_0499</edam_operation> - <edam_operation>operation_0492</edam_operation> - </edam_operations> - <requirements> - <requirement type="package" version="1.2.1">clustalo</requirement> - </requirements> - <version_command> - <![CDATA[ clustalo --version ]]> - </version_command> - <command> - <![CDATA[ - clustalo - --infile=$inputSequences - $inputFormat - $seqType - $dealign - $clusteringGuideTree - - #if ($iteration.iterOptions == "true") - --iterations=$iteration.nbrIter - $iteration.clusteringIteration - - #if ($iteration.separateIters.separateIterOptions == "true") - - --max-guidetree-iterations=$iteration.separateIters.maxGuideTreeIteration - --max-hmm-iterations=$iteration.separateIters.maxHmmIterations - #end if - #end if - $getTree - -o $output - --outfmt=${outputFormat} - --force - --threads \${GALAXY_SLOTS:-1} - ; - ]]> - </command> - <inputs> - <param name="inputSequences" format="fasta, clustal, msf, phylip, selex, stockholm" type="data" label="Sequences file"/> - <param name="inputFormat" label="Input format file" type="select"> - <option value="" selected="true">Auto</option> - <option value="--infmt=fasta">FASTA</option> - <option value="--infmt=clustal">Clustal</option> - <option value="--infmt=phylip">Phylip</option> - <option value="--infmt=msf">Msf</option> - <option value="--infmt=selex">Selex</option> - <option value="--infmt=stockholm">Stockholm</option> - <option value="--infmt=vienna">Vienna</option> - </param> - <param name="outputname" label="Name for output files" type="text" size="50" value="alignment" /> - <param name="seqType" type="select" label="Sequence type"> - <option value="" selected="true">Auto</option> - <option value="--seqtype=DNA">DNA</option> - <option value="--seqtype=RNA">RNA</option> - <option value="--seqtype=Protein">Protein</option> - </param> - <param name="dealign" type="boolean" falsevalue="" truevalue="--dealign" checked="false" label="Dealign input sequences" help="If given already aligned sequences, by default Clustal Omega use the existing alignment to guide creation of the new alignment, by constructing a HMM from the existing alignment. Check this box to realign aligned sequences from scratch."/> - <param name="clusteringGuideTree" type="select" label="Clustering guide-tree" help="By default, only a fraction of the distance matrix is calculated, for speed. Calculate full matrix may be more accurate under some circumstances but is slower and needs more memory."> - <option value="" selected="true">mBed-like</option> - <option value="--full">Use full distance matrix</option> - </param> - <conditional name="iteration"> - <param name="iterOptions" type="select" label="Use iteration" help="Redo the alignment multiple times to improve accuracy. Both the HMM and the guide tree will be recalculated each time."> - <option value="false" selected="true">Do not use iteration</option> - <option value="true">Use iteration</option> - </param> - <when value="false"/> - <when value="true"/> - <param name="clusteringIteration" type="select" label="Calculate full distance matrix during iteration"> - <option value="" selected="true">No</option> - <option value="--full-iter">Yes</option> - </param> - <param name="nbrIter" type="integer" value="1" min='0' max='5' label="Number of iterations (combined guide-tree/HMM)"/> - <conditional name="separateIters"> - <param name="separateIterOptions" type="select" label="Different number of guide tree, HMM iterations" help="Normally, if iteration is specified, a new guide tree and HMM will be calculated for each iteration. Use this option to restrict the number of iterations for either."> - <option value="false" selected="true">No</option> - <option value="true">Yes</option> - </param> - <when value="false"/> - <when value="true"/> - <param name="maxGuideTreeIteration" type="integer" value="1" min="0" max="5" label="Maximum guide tree iterations"/> - <param name="maxHmmIterations" type="integer" value="1" min="0" max="5" label="Maximum number of HMM iterations"/> - </conditional> - </conditional> - <param name="outputOrder" type="select" label="MSA output order"> - <option value="input-order">Input order</option> - <option value="tree-order" >Guide tree order</option> - </param> - <param name="getTree" type="select" label="Display tree guide"> - <option value="" selected="true">No</option> - <option value="--guidetree-out=guidetree.txt">Yes</option> - </param> - <param name="outputFormat" type="select" label="Alignment Output format"> - <option value="fasta" selected="true">FASTA</option> - <option value="clustal">Clustal</option> - <option value="phylip">Phylip</option> - <option value="msf">Msf</option> - <option value="selex">Selex</option> - <option value="stockholm">Stockholm</option> - <option value="vienna">Vienna</option> - </param> - </inputs> - <outputs> - <data name="output" format="fasta" label="${outputname}"> - <change_format> - <when input="outputFormat" value="clustal" format="clustal"/> - <when input="outputFormat" value="phylip" format="phylip"/> - <when input="outputFormat" value="msf" format="msf"/> - <when input="outputFormat" value="selex" format="selex"/> - <when input="outputFormat" value="stockholm" format="stockholm"/> - <when input="outputFormat" value="vienna" format="vienna" /> - </change_format> - </data> - <data name="guideTree" format="txt" label="${outputname} Guide tree" from_work_dir="guidetree.txt"> - <filter>getTree == "--guidetree-out=guidetree.txt"</filter> - </data> - </outputs> - <tests> - <test> - <param name="inputSequences" value="seqtest.fasta"/> - <param name="output" value="seqtest.aln.fasta"/> - </test> - <test> - <param name="inputSequences" value="seqtest.fasta"/> - <param name="clusteringIteration" value="--full-iter"/> - <param name="nbrIter" value="5"/> - <param name="maxGuideTreeIteration" value="5"/> - <param name="output" value="seqtest_aln2.fasta"/> - </test> - </tests> - <help> - <![CDATA[ - -.. class:: infomark - -**Clustal omega version 1.2.1** - -**What it does** - -Clustal-Omega is a general purpose multiple sequence alignment (MSA) program for protein and DNA/RNA. It produces high quality MSAs and is capable of handling data-sets of hundreds of thousands of sequences in reasonable time. - ------ - -For further informations, please visite the ClustalOmega_ website. - -.. _ClustalOmega: http://www.clustal.org/omega/ - ------ - -**OPTIONS** - -Sequence Input: - -i, --infile=<file> Multiple sequence input file (- for stdin) - --hmm-in=<file> HMM input files - --dealign Dealign input sequences - --profile1, --p1=<file> Pre-aligned multiple sequence file (aligned columns will be kept fix) - --profile2, --p2=<file> Pre-aligned multiple sequence file (aligned columns will be kept fix) - --is-profile Disable check if profile, force profile (default no) - -t, --seqtype *Protein, RNA, DNA* Force a sequence type (default: auto) - --infmt *fa[sta], clu[stal], msf, phy[lip], selex, st[ockholm], vie[nna]*. Forced sequence input file format (default: auto) - ------ - -Clustering: - --distmat-in=<file> Pairwise distance matrix input file (skips distance computation) - --distmat-out=<file> Pairwise distance matrix output file - --guidetree-in=<file> Guide tree input file (skips distance computation and guide-tree clustering step) - --guidetree-out=<file> Guide tree output file - --pileup Sequentially align sequences - --full Use full distance matrix for guide-tree calculation (might be slow; mBed is default) - --full-iter Use full distance matrix for guide-tree calculation during iteration (might be slowish; mBed is default) - --cluster-size=<n> soft maximum of sequences in sub-clusters - --clustering-out=<file> Clustering output file - --trans=<n> Use transitivity (default: 0) - --posterior-out=<file> Posterior probability output file - --use-kimura Use Kimura distance correction for aligned sequences (default no) - --percent-id convert distances into percent identities (default no) - ----- - -Alignment Output: - -o, --outfile=<file> Multiple sequence alignment output file (default: stdout) - --outfmt *fa[sta], clu[stal], msf, phy[lip], selex, st[ockholm], vie[nna]* MSA output file format (default: fasta) - --residuenumber, --resno in Clustal format print residue numbers (default no) - --wrap=<n> number of residues before line-wrap in output - --output-order *input-order, tree-order* MSA output order like in input/guide-tree - ----- - -Iteration: - --iterations, --iter=<n> Number of (combined guide-tree/HMM) iterations - --max-guidetree-iterations=<n> Maximum number of guidetree iterations - --max-hmm-iterations=<n> Maximum number of HMM iterations - ----- - -Limits (will exit early, if exceeded): - --maxnumseq=<n> Maximum allowed number of sequences - --maxseqlen=<l> Maximum allowed sequence length - ----- - -Miscellaneous: - --auto Set options automatically (might overwrite some of your options) - --threads=<n> Number of processors to use - --pseudo=<file> Input file for pseudo-count parameters - -l, --log=<file> Log all non-essential output to this file - -h, --help Print this help and exit - -v, --verbose Verbose output (increases if given multiple times) - --version Print version information and exit - --long-version Print long version information and exit - --force Force file overwriting - ]]> - </help> - <citations> - <citation type="doi">10.1038/msb.2011.75</citation> - </citations> -</tool>
--- a/clustalo/test-data/seqtest.fasta Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,35 +0,0 @@ ->TestSequence1 -ERNECFLKHKDDDPNLPPVVKPEPEALCTAFQENNNKFLENYLYEVARRHPYFYGPELLY -YVKQYKAILTECCQAACCQAADKATCLAPKAKVLKEKLLASSAKQRHKCASIQKFGERAA -AFKAWSIARLSQRFPKADFMDLSKLVTDLSKIHKECCHGDLLECADDREDLAKYVQDVCA -SFSSKLKECCDKPLLEKSHCISELENDDLPNDLPSITTDFVEDKDVCKLLNYKEAKDVFL -GTFLYEYSRRHPEYAVSLLLRIAKGYEATLERCCATDDAHACYSKVFDELQPLVDEPQLL -KLMKRNCELFENLGAYGFQNALIIRYTKKMPQVSTPTLLVISKELANMGNKCCTLPESKR ->TestSequence2 -ERADCFASHRDDNPGFPLMVRPPVDELCASYQADAQMFAGKYLYEVARRYPYFYAPELLY -YAQKLLYKDALAECCSAADKAACLTPKIDDLKESVMTSGAKQRFKCAGIEKFGERHGDLC -AFKAWAVARLSQKFPNADFAEISKIVTDLTKINKECCHGDLLECADDRVELGKYMCDNKD -SISSKLGKCCEKPLLEKGHCIAELERDDMPADLSPIEADFVEDKEVCKNYAEAKDVFLVC -GTFLYELSRRHPEYSVVMLLRLAKGYEAVLEKCCATGDPPACYAKVFDELKPLIDEPDEL -NLVKHNCELYGNLQEYGFQNALLIRYTKKMPQPTLVEVSRNLGKVGTKCCSLAEGERVCA ->TestSequence3 -ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYA -YANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERHGDLVCA -ALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQD -TISSKLKECCDKPLLEKSHCIAEVEKDAVPENLPPLTADFAEDKDVCKNYQEAKDAFLVC -GSFLYEYSRRHPEYVLLRLALLKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQVFL -NLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESER ->TestSequence4 -ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF -FAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERHGDLVCA -AFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQD -SISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLVC -GMFLYEYARRHPRESVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQLL -NLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKR ->TestSequence5 -ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY -YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERHGDLVFL -AFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQD -SISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLVC -GTFLYEYSRRHPSSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNQD -NLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAER \ No newline at end of file
--- a/clustalo/test-data/seqtest_aln.fasta Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,40 +0,0 @@ ->TestSequence1 -ERNECFLKHKDDDPNLPPVVKPEPEALCTAFQENNNKFLENYLYEVARRHPYFYGPELLY -YV--KQYKAILTECCQAACCQAADKATCLAPKAKVLKEKLLASSAKQRHKCASIQKFGER -AA-----AFKAWSIARLSQRFPKADFMDLSKLVTDLSKIHKECCHGDLLECADDREDLAK -YVQDVCASFSSKLKECCDKPLLEKSHCISELENDDLPNDLPSITTDFVEDKDVCKLLNYK -EAKDVFL--GTFLYEYSRRHPEYAVSLLLRIAKGYEATLERCCATDDAHACYSKVFDELQ -PLVDEPQL-LKLMKRNCELFENLGAYGFQNALIIRYTKKMPQVSTPTLLVISKELANMGN -KCCTLPESKR--- ->TestSequence2 -ERADCFASHRDDNPGFPLMVRPPVDELCASYQADAQMFAGKYLYEVARRYPYFYAPELLY -YAQKLLYKDALAEC-----CSAADKAACLTPKIDDLKESVMTSGAKQRFKCAGIEKFGER -HGDLC--AFKAWAVARLSQKFPNADFAEISKIVTDLTKINKECCHGDLLECADDRVELGK -YMCDNKDSISSKLGKCCEKPLLEKGHCIAELERDDMPADLSPIEADFVEDKEVCK--NYA -EAKDVFLVCGTFLYELSRRHPEYSVVMLLRLAKGYEAVLEKCCATGDPPACYAKVFDELK -PLIDEPDE-LNLVKHNCELYGNLQEYGFQNALLIRYTKKMPQ---PTLVEVSRNLGKVGT -KCCSLAEGERVCA ->TestSequence3 -ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY -AY-ANKYNGVFQEC-----CQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGER -HGDLVCAALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAK -YICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAVPENLPPLTADFAEDKDVCK--NYQ -EAKDAFLVCGSFLYEYSRRHPE-YVLLRLALLKEYEATLEECCAKDDPHACYSTVFDKLK -HLVDEPQVFLNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGT -RCCTKPESER--- ->TestSequence4 -ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF --F-AKRYKAAFTEC-----CQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGER -HGDLVCAAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAK -YICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCK--NYA -EAKDVFLVCGMFLYEYARRHPRESVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFK -PLVEEPQL-LNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGS -KCCKHPEAKR--- ->TestSequence5 -ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY --Y-AEEYKGVFTEC-----CEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGER -HGDLVFLAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAK -YICENQDSISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCK--NYQ -EAKDVFLVCGTFLYEYSRRHPS-SVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFK -PLVEEPHNQDNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGS -KCCTHPEAER---
--- a/clustalo/test-data/seqtest_aln2.fasta Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,40 +0,0 @@ ->TestSequence1 -ERNECFLKHKDDDPNLPPVVKPEPEALCTAFQENNNKFLENYLYEVARRHPYFYGPELLY -YV--KQYKAILTECCQAACCQAADKATCLAPKAKVLKEKLLASSAKQRHKCASIQKFGER -AA-----AFKAWSIARLSQRFPKADFMDLSKLVTDLSKIHKECCHGDLLECADDREDLAK -YVQDVCASFSSKLKECCDKPLLEKSHCISELENDDLPNDLPSITTDFVEDKDVCKLLNYK -EAKDVFL--GTFLYEYSRRHPEYAVSLLLRIAKGYEATLERCCATDDAHACYSKVFDELQ -PLVDEPQL-LKLMKRNCELFENLGAYGFQNALIIRYTKKMPQVSTPTLLVISKELANMGN -KCCTLPESKR--- ->TestSequence2 -ERADCFASHRDDNPGFPLMVRPPVDELCASYQADAQMFAGKYLYEVARRYPYFYAPELLY -YAQKLLYKDALAECC-----SAADKAACLTPKIDDLKESVMTSGAKQRFKCAGIEKFGER -HGDLC--AFKAWAVARLSQKFPNADFAEISKIVTDLTKINKECCHGDLLECADDRVELGK -YMCDNKDSISSKLGKCCEKPLLEKGHCIAELERDDMPADLSPIEADFVEDKEVCK--NYA -EAKDVFLVCGTFLYELSRRHPEYSVVMLLRLAKGYEAVLEKCCATGDPPACYAKVFDELK -PLIDEPDE-LNLVKHNCELYGNLQEYGFQNALLIRYTKKMPQ---PTLVEVSRNLGKVGT -KCCSLAEGERVCA ->TestSequence3 -ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY -AYA-NKYNGVFQECC-----QAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGER -HGDLVCAALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAK -YICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAVPENLPPLTADFAEDKDVCK--NYQ -EAKDAFLVCGSFLYEYSRRHPE-YVLLRLALLKEYEATLEECCAKDDPHACYSTVFDKLK -HLVDEPQVFLNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGT -RCCTKPESER--- ->TestSequence4 -ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF -F-A-KRYKAAFTECC-----QAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGER -HGDLVCAAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAK -YICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCK--NYA -EAKDVFLVCGMFLYEYARRHPRESVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFK -PLVEEPQL-LNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGS -KCCKHPEAKR--- ->TestSequence5 -ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY -Y-A-EEYKGVFTECC-----EAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGER -HGDLVFLAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAK -YICENQDSISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCK--NYQ -EAKDVFLVCGTFLYEYSRRHPS-SVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFK -PLVEEPHNQDNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGS -KCCTHPEAER---
--- a/muscle/muscle.xml Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,120 +0,0 @@ -<tool id="muscle" name="MUSCLE" version="3.8.31.1"> - <description>MUltiple Sequence Comparison by Log- Expectation</description> - <edam_operations> - <edam_operation>operation_0492</edam_operation> - </edam_operations> - <requirements> - <requirement type="package" version="3.8.31">muscle</requirement> - </requirements> - <version_command> - <![CDATA[ muscle -version ]]> - </version_command> - <command> - muscle - ##Do not display progress messages - -quiet - -in $input - -out $output - - #if $mode.run == "custom" : - -maxiters $mode.iterations - #else: - -maxiters $mode.run - #end if - - -cluster1 $cluster - $diags - $outputFormat - </command> - <inputs> - <param name="input" type="data" format="fasta" label="Source file" help="Fasta sequence file"/> - <conditional name="mode"> - <param name="run" type="select" label="Run mode"> - <option value="2">Progressive mode (faster)</option> - <option value="1">Fastest mode</option> - <option value="16" selected="true" >Full mode</option> - <option value="custom">Custom mode</option> - </param> - <when value="2" /> - <when value="1" /> - <when value="16" /> - <when value="custom"> - <param name="iterations" type="integer" min='1' value="16" label="Maximum number of iterations" help="Increase the quality, increase the computing time"/> - </when> - </conditional> - - <param name="diags" type="boolean" truevalue="-diags" falsevalue="" checked="False" label="Find diagonals" help="Faster for similar sequences" /> - - <param name="cluster" type="select" label="Clustering method"> - <option value="upgma">UPGMA</option> - <option value="upgmb" selected="true" >UPGMB</option> - <option value="neighborjoining">Neighbor Joining</option> - </param> - <param name="outputFormat" type="select" label="Output format" help="Either Fasta, Phylip"> - <option value="" selected="true">Fasta</option> - <option value="-phyi">Phylip Interleaved format</option> - <option value="-phys">Phylip Sequential format</option> - </param> - </inputs> - <outputs> - <data name="output" format="fasta" label="MUSCLE Aligned sequencies "> - <change_format> - <when input="outputFormat" value="" format="fasta"/> - <when input="outputFormat" value="-phyi" format="phylip"/> - <when input="outputFormat" value="-phys" format="phylip"/> - </change_format> - </data> - </outputs> - <tests> - <test> - <param name="input" value="seqtest.fasta"/> - <param name="output" value="seqtest_aln.fasta"/> - </test> - </tests> - <help> - -.. class:: infomark - -**MUSCLE version 3.8.31, 2004** - ------ - -============== - Please cite: -============== - -"MUSCLE: multiple sequence_ alignment with high accuracy and high throughput." - - -.. _sequence: http://nar.oxfordjournals.org/content/32/5/1792.long - -**Edgar R.C.** - -Nucleic Acids Res. 32(5):1792-1797, doi:10.1093/nar/gkh340, 2004. - -"MUSCLE: a multiple sequence alignment_ method with reduced time and space complexity." - - -.. _alignment: http://www.biomedcentral.com/1471-2105/5/113/ - -**Edgar R.C.** - -BMC Bioinformatics, (5) 113, 2004. - ------ - -========== - Overview -========== - -MUSCLE is a program for creating multiple alignments of amino acid or nucleotide sequences. A range of options is provided that give you the choice of optimizing accuracy, speed, or some compromise between the two. - ------ - -For further informations, please visite the MUSCLE_ website. - -.. _MUSCLE: http://www.drive5.com/muscle/ - - </help> - -</tool>
--- a/muscle/test-data/seqtest.fasta Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,35 +0,0 @@ ->TestSequence1 -ERNECFLKHKDDDPNLPPVVKPEPEALCTAFQENNNKFLENYLYEVARRHPYFYGPELLY -YVKQYKAILTECCQAACCQAADKATCLAPKAKVLKEKLLASSAKQRHKCASIQKFGERAA -AFKAWSIARLSQRFPKADFMDLSKLVTDLSKIHKECCHGDLLECADDREDLAKYVQDVCA -SFSSKLKECCDKPLLEKSHCISELENDDLPNDLPSITTDFVEDKDVCKLLNYKEAKDVFL -GTFLYEYSRRHPEYAVSLLLRIAKGYEATLERCCATDDAHACYSKVFDELQPLVDEPQLL -KLMKRNCELFENLGAYGFQNALIIRYTKKMPQVSTPTLLVISKELANMGNKCCTLPESKR ->TestSequence2 -ERADCFASHRDDNPGFPLMVRPPVDELCASYQADAQMFAGKYLYEVARRYPYFYAPELLY -YAQKLLYKDALAECCSAADKAACLTPKIDDLKESVMTSGAKQRFKCAGIEKFGERHGDLC -AFKAWAVARLSQKFPNADFAEISKIVTDLTKINKECCHGDLLECADDRVELGKYMCDNKD -SISSKLGKCCEKPLLEKGHCIAELERDDMPADLSPIEADFVEDKEVCKNYAEAKDVFLVC -GTFLYELSRRHPEYSVVMLLRLAKGYEAVLEKCCATGDPPACYAKVFDELKPLIDEPDEL -NLVKHNCELYGNLQEYGFQNALLIRYTKKMPQPTLVEVSRNLGKVGTKCCSLAEGERVCA ->TestSequence3 -ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYA -YANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERHGDLVCA -ALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQD -TISSKLKECCDKPLLEKSHCIAEVEKDAVPENLPPLTADFAEDKDVCKNYQEAKDAFLVC -GSFLYEYSRRHPEYVLLRLALLKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQVFL -NLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESER ->TestSequence4 -ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF -FAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERHGDLVCA -AFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQD -SISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLVC -GMFLYEYARRHPRESVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQLL -NLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKR ->TestSequence5 -ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY -YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERHGDLVFL -AFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQD -SISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLVC -GTFLYEYSRRHPSSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNQD -NLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAER \ No newline at end of file
--- a/muscle/test-data/seqtest_aln.fasta Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,40 +0,0 @@ ->TestSequence1 -ERNECFLKHKDDDPNLPPVVKPEPEALCTAFQENNNKFLENYLYEVARRHPYFYGPELLY --YVKQ--YKAILTECCQAACCQAADKATCLAPKAKVLKEKLLASSAKQRHKCASIQKFGE -RAA-----AFKAWSIARLSQRFPKADFMDLSKLVTDLSKIHKECCHGDLLECADDREDLA -KYVQDVCASFSSKLKECCDKPLLEKSHCISELENDDLPNDLPSITTDFVEDKDVCKLLNY -KEAKDVFL--GTFLYEYSRRHPEYAVSLLLRIAKGYEATLERCCATDDAHACYSKVFDEL -QPLVDEPQLL-KLMKRNCELFENLGAYGFQNALIIRYTKKMPQVSTPTLLVISKELANMG -NKCCTLPESKR--- ->TestSequence2 -ERADCFASHRDDNPGFPLMVRPPVDELCASYQADAQMFAGKYLYEVARRYPYFYAPELLY --YAQKLLYKDALAEC-----CSAADKAACLTPKIDDLKESVMTSGAKQRFKCAGIEKFGE -RHGDLC--AFKAWAVARLSQKFPNADFAEISKIVTDLTKINKECCHGDLLECADDRVELG -KYMCDNKDSISSKLGKCCEKPLLEKGHCIAELERDDMPADLSPIEADFVEDKEVCK--NY -AEAKDVFLVCGTFLYELSRRHPEYSVVMLLRLAKGYEAVLEKCCATGDPPACYAKVFDEL -KPLIDEPDEL-NLVKHNCELYGNLQEYGFQNALLIRYTKKMPQ---PTLVEVSRNLGKVG -TKCCSLAEGERVCA ->TestSequence3 -ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY -AYANK--YNGVFQEC-----CQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGE -RHGDLVCAALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLA -KYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAVPENLPPLTADFAEDKDVCK--NY -QEAKDAFLVCGSFLYEYSRRHPEY-VLLRLALLKEYEATLEECCAKDDPHACYSTVFDKL -KHLVDEPQVFLNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVG -TRCCTKPESER--- ->TestSequence4 -ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF --FAKR--YKAAFTEC-----CQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGE -RHGDLVCAAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLA -KYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCK--NY -AEAKDVFLVCGMFLYEYARRHPRESVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF -KPLVEEPQLL-NLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVG -SKCCKHPEAKR--- ->TestSequence5 -ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY --YAEE--YKGVFTEC-----CEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGE -RHGDLVFLAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLA -KYICENQDSISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCK--NY -QEAKDVFLVCGTFLYEYSRRHPS-SVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEF -KPLVEEPHNQDNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVG -SKCCTHPEAER---
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/phyml_oneclick/phyml_3_0_oneclick.xml Thu Jan 26 10:05:45 2017 -0500 @@ -0,0 +1,345 @@ +<tool id="phyml_oneclick" name="PhyML Oneclick" version="3.0_360-500M"> + <description>Phylogeny software based on the maximum-likelihood</description> + <edam_operations> + <edam_operation>operation_0540</edam_operation> + <edam_operation>operation_0324</edam_operation> + </edam_operations> + <requirements> + <requirement type="package" version="3.0_360-500M">phyml</requirement> + </requirements> + <version_command> + <![CDATA[ phyml --version ]]> + </version_command> + <stdio> + <regex match="*" + source="stdrr" + level="fatal"/> + </stdio> + <command> + <![CDATA[ + ##PhyML outputs are based on input path and we need to create outputs in working_dir. + ln -sf $input '${input.name}'; + #if ($usetree.inputTree == "true"): + ln -sf ${$usetree.userInputTree} ${$usetree.userInputTree.name}; + #end if + + phyml --input '${input.name}' + ${phylip_format} + + #if $seq.type_of_seq == "cfg" + + ## Read information of sequence type + ## read an info file to choose which option set and set a model by default + #set $info = open( str($input_info) ).read() + + #if 'dna' in $info: + --datatype nt + --model HKY85 + -f e + + #else if 'protein' in $info: + --datatype aa + --model WAG + -f m + + #end if + #else + --datatype ${seq.type_of_seq} + --model ${seq.model} + -f ${equi_freq} + + #end if + + --multiple ${nb_data_set} + + #if (str($support_condition.branchSupport) in ['0','-1','-2','-4','-5']): + --bootstrap ${support_condition.branchSupport} + #else: + --bootstrap ${support_condition.branchSupport.replicate} + #end if + + #if ($seq.type_of_seq == "nt"): + -t ${seq.tstv} + #end if + + + --pinv ${prop_invar} + + --nclasses ${nbSubstCat} + + #if (str($nbSubstCat) != "1"): + --alpha ${gamma} + #end if + + --search ${move} + -o ${optimisationTopology} + + #if ($usetree.inputTree == "true"): + --inputtree ${$usetree.userInputTree.name} + #end if + + #if ($numStartSeed != "0"): + --r_seed ${numStartSeed} + #end if + + > ${output_stdout}; + grep 'failed' ${output_stdout} >&2; + ]]> + </command> + <inputs> + <param name="input" type="data" format="phylip, phy" label="Alignment file" help="phylip format"/> + <param name="phylip_format" type="select" label="Changes interleaved format" display="radio"> + <option value="">Interleaved</option> + <option value="--sequential">Sequential</option> + </param> + <param name="nb_data_set" type="integer" min="1" value="1" label="Number of data sets" /> + <conditional name="seq"> + <param name="type_of_seq" type="select" label="Data type" display="radio"> + <option value="nt">Nucleic acids</option> + <option value="aa">Amino acids</option> + <option value="cfg">Type information file</option> + </param> + <when value="nt"> + <param name="tstv" type="text" value="e" label="Transition/transversion ratio" help="Must be a positive integer, 'e' if you want PhyML to estimate it" /> + <param name="model" type="select" label="Substitution model"> + <option value="HKY85">HKY85</option> + <option value="JC69">JC69</option> + <option value="K80">K80</option> + <option value="F81">F81</option> + <option value="F84">F84</option> + <option value="TN93">TN93</option> + <option value="GTR">GTR</option> + </param> + </when> + <when value="aa"> + <param name="model" type="select" label="Evolution model"> + <option value="LG">LG</option> + <option value="WAG">WAG</option> + <option value="JTT">JTT</option> + <option value="MtREV">MtREV</option> + <option value="Dayhoff">Dayhoff</option> + <option value="DCMut">DCMut</option> + <option value="RtREV">RtREV</option> + <option value="CpREV">CpREV</option> + <option value="VT">VT</option> + <option value="Blosum62">Blosum62</option> + <option value="MtMam">MtMam</option> + <option value="MtArt">MtArt</option> + <option value="HIVw">HIVw</option> + <option value="HIVb">HIVb</option> + </param> + </when> + <when value="cfg"> + <param name="input_info" format="txt" type="data" multiple="false" label="Config file" help="Precompute file containning sequence description (dna or protein)"/> + </when> + </conditional> + <param name="prop_invar" type="text" value="e" label="Proportion of invariant sites" help="Can be a fixed value in the [0,1] range or 'e' to get the maximum likelihood estimate, 0 to ignore this parameter"/> + <param name="equi_freq" type="select" label="Equilibrium frequencies" help="Empirical: frequencies are estimated by counting the occurences in the alignment. ML/Model: frequencies are estimated using ML for nucleotides or defined by the proteic substitution model."> + <option value="m">ML/Model</option> + <option value="e">Empirical</option> + </param> + <param name="nbSubstCat" type="integer" min="1" value="4" label="Number of categories for the discrete gamma model" help="1 means no gamma model" /> + <param name="gamma" type="text" value="e" label="Parameter of the gamma model" help="'e' if you want PhyML to estimate it"/> + <param name="move" type="select" label="Tree topology search" display="radio"> + <option value="NNI">NNI (Nearest Neighbor Interchange)</option> + <option value="SPR">SPR (Subtree Pruning and Regraphing)</option> + <option value="BEST">Best of NNI and SPR</option> + </param> + <param name="optimisationTopology" type="select" label="Optimise topology"> + <option value="tlr">Tree topology, Branch length, Rate parameter</option> + <option value="tl">Tree topology, Branch length</option> + <option value="l">Branch length</option> + <option value="r">Rate parameter</option> + <option value="n">No parameter is optimized</option> + </param> + <conditional name="support_condition"> + <param name="branchSupport" type="select" label="Statistical tests for branch support" help="Use aLRT or aBayes to save computing time"> + <option value="0">No bootstrap</option> + <option value="1">Bootstrap</option> + <option value="-1">likelihood aLRT statistics</option> + <option value="-2">likelihood Chi2-based</option> + <option value="-4" selected='true'>SH-like</option> + <option value="-5">Approximate Bayes branch supports</option> + </param> + <when value="0"/> + <when value="-1"/> + <when value="-2"/> + <when value="-4"/> + <when value="-5"/> + <when value="1"> + <param name="replicate" type="integer" min="1" value="100" label="Number of bootstrap replicates" help="Must be a positive integer" /> + </when> + </conditional> + <param name="numStartSeed" type="integer" value="0" label="Number of seed used to initiate the random number generator" help="0 to random seed"/> + <conditional name="usetree"> + <param name="inputTree" type="boolean" truevalue="true" falsevalue="false" checked="False" label="Use input tree guide" /> + <when value="true"> + <param name="userInputTree" type="data" label="Tree file" help="newick format"/> + </when> + <when value="false"/> + </conditional> + </inputs> + <outputs> + <data name="output_tree" format="nhx" label="PhyML Newick tree: ${input.name}.nwk" from_work_dir="*_phyml_tree.txt" /> + <data name="output_stats" format="txt" label="PhyML Statistic: ${input.name}.stats.txt" from_work_dir="*_phyml_stats.txt"/> + <data name="output_stdout" format="txt" label="PhyML Stdout: ${input.name}"/> + </outputs> + <tests> + <test> + <param name="input" value="phylip" /> + <param name="prop_invar" value="0"/> + <param name="type_of_seq" value="nt" /> + <param name="numStartSeed" value="1458308600" /> + <output name="output_tree" file="phylip_phyml_tree.txt" /> + <output name="output_stats" file="phylip_phyml_stats.txt" lines_diff="4"/> + </test> + </tests> + <help> + <![CDATA[ +.. class:: infomark + +**PhyML version 3.0 ** + +----- + +######### +PhyML 3.0 +######### + +A simple, fast, and accurate algorithm to estimate +large phylogenies by maximum likelihood'' + +========== + Overview: +========== + +PhyML is a phylogeny software based on the maximum-likelihood principle. Early PhyML versions used a fast algorithm to perform Nearest Neighbor Interchanges (NNIs), in order to improve a reasonable starting tree topology. Since the original publication (Guindon and Gascuel 2003), PhyML has been widely used due to its simplicity and a fair accuracy/speed compromise. In the mean time research around PhyML has continued. + +We designed an efficient algorithm to search the tree space using Subtree Pruning and Regrafting (SPR) topological moves (Hordijk and Gascuel 2005), and proposed a fast branch test based on an approximate likelihood ratio test (Anisimova and Gascuel 2006). However, these novelties were not included in the official version of PhyML, and we found that improvements were still needed in order to make them effective in some practical cases. PhyML 3.0 achieves this task. + +It implements new algorithms to search the space of tree topologies with user-defined intensity. A non-parametric, Shimodaira-Hasegawa-like branch test is also available. The program provides a number of new evolutionary models and its interface was entirely re-designed. We tested PhyML 3.0 on a large collection of real data sets to ensure that the new version is stable, ready-to-use and still reasonably fast and accurate. + +----- + + +For further informations, please visite the PhyML_ website. + +.. _PhyML: http://www.atgc-montpellier.fr/phyml/ + +Please cite this paper if you use this software in your publications. + + +----- + +OPTIONS +======= + + + -i, --input seq_file_name + seq_file_name is the name of the nucleotide or amino-acid sequence file in PHYLIP format. + + -d, --datatype data_type + data_type is 'nt' for nucleotide (default), 'aa' for amino-acid sequences, or 'generic', + (use NEXUS file format and the 'symbols' parameter here). + + -q, --sequential + Changes interleaved format (default) to sequential format. + + + -n, --multiple nb_data_sets + nb_data_sets is an integer corresponding to the number of data sets to analyse. + + -p, --pars + Use a minimum parsimony starting tree. This option is taken into account when the '-u' option + is absent and when tree topology modifications are to be done. + + -b, --bootstrap int + + - *int > 0*: int is the number of bootstrap replicates. + - *int = 0*: neither approximate likelihood ratio test nor bootstrap values are computed. + - *int = -1*: approximate likelihood ratio test returning aLRT statistics. + - *int = -2*: approximate likelihood ratio test returning Chi2-based parametric branch supports. + - *int = -4*: (default) SH-like branch supports alone. + - *int = -5*: approximate Bayes branch supports. + -m, --model model + model : substitution model name. + + - Nucleotide-based models : HKY85 (default) | JC69 | K80 | F81 | F84 | TN93 | GTR | custom(*) + + (*) : *for the custom option, a string of six digits identifies the model. For instance, 00000 corresponds to F81, JC69 provided the distribution of nucleotide frequencies is uniform). 012345 corresponds to GTR. This option can be used for encoding any model that is a nested within GTR.* + + * Amino-acid based models : LG (default) | WAG | JTT | MtREV | Dayhoff | DCMut | RtREV | CpREV | VT + Blosum62 | MtMam | MtArt | HIVw | HIVb | custom(**) + + (**) **--aa_rate_file** *filename* file that provides the amino acid substitution rate matrix in PAML format. + It is compulsory to use this option when analysing amino acid sequences with the "custom" model. + + -f frequency + - *"e"*: the character frequencies are determined as follows : + - Nucleotide sequences: (Empirical) the equilibrium base frequencies are estimated by counting the occurence of the different bases in the alignment. + - Amino-acid sequences: (Empirical) the equilibrium amino-acid frequencies are estimated by counting the occurence of the different amino-acids in the alignment. + - *"m"* : the character frequencies are determined as follows : + - Nucleotide sequences: (ML) the equilibrium base frequencies are estimated using maximum likelihood + - Amino-acid sequences: (Model) the equilibrium amino-acid frequencies are estimated using the frequencies defined by the substitution model. + - *"fA,fC,fG,fT"*: only valid for nucleotide-based models. fA, fC, fG and fT are floating numbers that correspond to the frequencies of A, C, G and T respectively *(WARNING: do not use any blank space between your values of nucleotide frequencies, only commas!)*. + + -t ts_tv_ratio + ts_tv_ratio : transition/transversion ratio. DNA sequences only. + Can be a fixed positive value (ex:4.0) or e to get the maximum likelihood estimate. + + -v, --pinv prop_invar + prop_invar : proportion of invariable sites. + Can be a fixed value in the [0,1] range or e to get the maximum likelihood estimate. + + -c, --nclasses nb_subst_cat + nb_subst_cat : number of relative substitution rate categories. Default : nb_subst_cat=4. + Must be a positive integer. + + -a, --alpha gamma + gamma : distribution of the gamma distribution shape parameter. + Can be a fixed positive value or e to get the maximum likelihood estimate. + + -s, --search move + Tree topology search operation option. + Can be either NNI (default, fast) or SPR (a bit slower than NNI) or BEST (best of NNI and SPR search). + + -u, --inputtree user_tree_file + user_tree_file : starting tree filename. The tree must be in Newick format. + + -o params + This option focuses on specific parameter optimisation. + + - *tlr* : tree topology (t), branch length (l) and rate parameters (r) are optimised. + - *tl* : tree topology and branch length are optimised. + - *r* : branch length and rate parameters are optimised. + - *l* : branch length are optimised. + - *r* : rate parameters are optimised. + - *n* : no parameter is optimised. + --rand_start This option sets the initial tree to random. + It is only valid if SPR searches are to be performed. + --n_rand_starts integer + Number of initial random trees to be used. + It is only valid if SPR searches are to be performed. + --r_seed integer + Number of the seed used to initiate the random number generator. + --print_site_lnl + Print the likelihood for each site in file *\*_phyml_lk.txt* + --print_trace + Print each phylogeny explored during the tree search process in file *\*_phyml_trace.txt*. + --run_id ID_string + Append the string ID_string at the end of each PhyML output file. + This option may be useful when running simulations involving PhyML. + --quiet + No interactive question (for running in batch mode) and quiet output. + --alias_subpatt + Site aliasing is generalized at the subtree level. Sometimes lead to faster calculations. + See Kosakovsky Pond SL, Muse SV, Sytematic Biology (2004) for an example. + --boot_progress_display num (default=20) + num is the frequency at which the bootstrap progress bar will be updated. + Must be an integer. + ]]> + </help> + <citations> + <citation type="doi">10.1093/sysbio/syq010</citation> + </citations> +</tool>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/phyml_oneclick/phyml_3_1_oneclick.xml Thu Jan 26 10:05:45 2017 -0500 @@ -0,0 +1,345 @@ +<tool id="phyml_oneclick" name="PhyML Oneclick" version="3.1"> + <description>Phylogeny software based on the maximum-likelihood</description> + <edam_operations> + <edam_operation>operation_0540</edam_operation> + <edam_operation>operation_0324</edam_operation> + </edam_operations> + <requirements> + <requirement type="package" version="3.1">phyml</requirement> + </requirements> + <version_command> + <![CDATA[ phyml --version ]]> + </version_command> + <stdio> + <regex match="*" + source="stdrr" + level="fatal"/> + </stdio> + <command> + <![CDATA[ + ##PhyML outputs are based on input path and we need to create outputs in working_dir. + ln -sf $input '${input.name}'; + #if ($usetree.inputTree == "true"): + ln -sf ${$usetree.userInputTree} ${$usetree.userInputTree.name}; + #end if + + phyml --input '${input.name}' + ${phylip_format} + + #if $seq.type_of_seq == "cfg" + + ## Read information of sequence type + ## read an info file to choose which option set and set a model by default + #set $info = open( str($input_info) ).read() + + #if 'dna' in $info: + --datatype nt + --model HKY85 + -f e + + #else if 'protein' in $info: + --datatype aa + --model WAG + -f m + + #end if + #else + --datatype ${seq.type_of_seq} + --model ${seq.model} + -f ${equi_freq} + + #end if + + --multiple ${nb_data_set} + + #if (str($support_condition.branchSupport) in ['0','-1','-2','-4','-5']): + --bootstrap ${support_condition.branchSupport} + #else: + --bootstrap ${support_condition.branchSupport.replicate} + #end if + + #if ($seq.type_of_seq == "nt"): + -t ${seq.tstv} + #end if + + + --pinv ${prop_invar} + + --nclasses ${nbSubstCat} + + #if (str($nbSubstCat) != "1"): + --alpha ${gamma} + #end if + + --search ${move} + -o ${optimisationTopology} + + #if ($usetree.inputTree == "true"): + --inputtree ${$usetree.userInputTree.name} + #end if + + #if ($numStartSeed != "0"): + --r_seed ${numStartSeed} + #end if + + > ${output_stdout}; + grep 'failed' ${output_stdout} >&2; + ]]> + </command> + <inputs> + <param name="input" type="data" format="phylip, phy" label="Alignment file" help="phylip format"/> + <param name="phylip_format" type="select" label="Changes interleaved format" display="radio"> + <option value="">Interleaved</option> + <option value="--sequential">Sequential</option> + </param> + <param name="nb_data_set" type="integer" min="1" value="1" label="Number of data sets" /> + <conditional name="seq"> + <param name="type_of_seq" type="select" label="Data type" display="radio"> + <option value="nt">Nucleic acids</option> + <option value="aa">Amino acids</option> + <option value="cfg">Type information file</option> + </param> + <when value="nt"> + <param name="tstv" type="text" value="e" label="Transition/transversion ratio" help="Must be a positive integer, 'e' if you want PhyML to estimate it" /> + <param name="model" type="select" label="Substitution model"> + <option value="HKY85">HKY85</option> + <option value="JC69">JC69</option> + <option value="K80">K80</option> + <option value="F81">F81</option> + <option value="F84">F84</option> + <option value="TN93">TN93</option> + <option value="GTR">GTR</option> + </param> + </when> + <when value="aa"> + <param name="model" type="select" label="Evolution model"> + <option value="LG">LG</option> + <option value="WAG">WAG</option> + <option value="JTT">JTT</option> + <option value="MtREV">MtREV</option> + <option value="Dayhoff">Dayhoff</option> + <option value="DCMut">DCMut</option> + <option value="RtREV">RtREV</option> + <option value="CpREV">CpREV</option> + <option value="VT">VT</option> + <option value="Blosum62">Blosum62</option> + <option value="MtMam">MtMam</option> + <option value="MtArt">MtArt</option> + <option value="HIVw">HIVw</option> + <option value="HIVb">HIVb</option> + </param> + </when> + <when value="cfg"> + <param name="input_info" format="txt" type="data" multiple="false" label="Config file" help="Precompute file containning sequence description (dna or protein)"/> + </when> + </conditional> + <param name="prop_invar" type="text" value="e" label="Proportion of invariant sites" help="Can be a fixed value in the [0,1] range or 'e' to get the maximum likelihood estimate, 0 to ignore this parameter"/> + <param name="equi_freq" type="select" label="Equilibrium frequencies" help="Empirical: frequencies are estimated by counting the occurences in the alignment. ML/Model: frequencies are estimated using ML for nucleotides or defined by the proteic substitution model."> + <option value="m">ML/Model</option> + <option value="e">Empirical</option> + </param> + <param name="nbSubstCat" type="integer" min="1" value="4" label="Number of categories for the discrete gamma model" help="1 means no gamma model" /> + <param name="gamma" type="text" value="e" label="Parameter of the gamma model" help="'e' if you want PhyML to estimate it"/> + <param name="move" type="select" label="Tree topology search" display="radio"> + <option value="NNI">NNI (Nearest Neighbor Interchange)</option> + <option value="SPR">SPR (Subtree Pruning and Regraphing)</option> + <option value="BEST">Best of NNI and SPR</option> + </param> + <param name="optimisationTopology" type="select" label="Optimise topology"> + <option value="tlr">Tree topology, Branch length, Rate parameter</option> + <option value="tl">Tree topology, Branch length</option> + <option value="l">Branch length</option> + <option value="r">Rate parameter</option> + <option value="n">No parameter is optimized</option> + </param> + <conditional name="support_condition"> + <param name="branchSupport" type="select" label="Statistical tests for branch support" help="Use aLRT or aBayes to save computing time"> + <option value="0">No bootstrap</option> + <option value="1">Bootstrap</option> + <option value="-1">likelihood aLRT statistics</option> + <option value="-2">likelihood Chi2-based</option> + <option value="-4" selected='true'>SH-like</option> + <option value="-5">Approximate Bayes branch supports</option> + </param> + <when value="0"/> + <when value="-1"/> + <when value="-2"/> + <when value="-4"/> + <when value="-5"/> + <when value="1"> + <param name="replicate" type="integer" min="1" value="100" label="Number of bootstrap replicates" help="Must be a positive integer" /> + </when> + </conditional> + <param name="numStartSeed" type="integer" value="0" label="Number of seed used to initiate the random number generator" help="0 to random seed"/> + <conditional name="usetree"> + <param name="inputTree" type="boolean" truevalue="true" falsevalue="false" checked="False" label="Use input tree guide" /> + <when value="true"> + <param name="userInputTree" type="data" label="Tree file" help="newick format"/> + </when> + <when value="false"/> + </conditional> + </inputs> + <outputs> + <data name="output_tree" format="nhx" label="PhyML Newick tree: ${input.name}.nwk" from_work_dir="*_phyml_tree.txt" /> + <data name="output_stats" format="txt" label="PhyML Statistic: ${input.name}.stats.txt" from_work_dir="*_phyml_stats.txt"/> + <data name="output_stdout" format="txt" label="PhyML Stdout: ${input.name}"/> + </outputs> + <tests> + <test> + <param name="input" value="phylip" /> + <param name="prop_invar" value="0"/> + <param name="type_of_seq" value="nt" /> + <param name="numStartSeed" value="1458308600" /> + <output name="output_tree" file="phylip_phyml_tree.txt" /> + <output name="output_stats" file="phylip_phyml_stats.txt" lines_diff="4"/> + </test> + </tests> + <help> + <![CDATA[ +.. class:: infomark + +**PhyML version 3.0 ** + +----- + +######### +PhyML 3.0 +######### + +A simple, fast, and accurate algorithm to estimate +large phylogenies by maximum likelihood'' + +========== + Overview: +========== + +PhyML is a phylogeny software based on the maximum-likelihood principle. Early PhyML versions used a fast algorithm to perform Nearest Neighbor Interchanges (NNIs), in order to improve a reasonable starting tree topology. Since the original publication (Guindon and Gascuel 2003), PhyML has been widely used due to its simplicity and a fair accuracy/speed compromise. In the mean time research around PhyML has continued. + +We designed an efficient algorithm to search the tree space using Subtree Pruning and Regrafting (SPR) topological moves (Hordijk and Gascuel 2005), and proposed a fast branch test based on an approximate likelihood ratio test (Anisimova and Gascuel 2006). However, these novelties were not included in the official version of PhyML, and we found that improvements were still needed in order to make them effective in some practical cases. PhyML 3.0 achieves this task. + +It implements new algorithms to search the space of tree topologies with user-defined intensity. A non-parametric, Shimodaira-Hasegawa-like branch test is also available. The program provides a number of new evolutionary models and its interface was entirely re-designed. We tested PhyML 3.0 on a large collection of real data sets to ensure that the new version is stable, ready-to-use and still reasonably fast and accurate. + +----- + + +For further informations, please visite the PhyML_ website. + +.. _PhyML: http://www.atgc-montpellier.fr/phyml/ + +Please cite this paper if you use this software in your publications. + + +----- + +OPTIONS +======= + + + -i, --input seq_file_name + seq_file_name is the name of the nucleotide or amino-acid sequence file in PHYLIP format. + + -d, --datatype data_type + data_type is 'nt' for nucleotide (default), 'aa' for amino-acid sequences, or 'generic', + (use NEXUS file format and the 'symbols' parameter here). + + -q, --sequential + Changes interleaved format (default) to sequential format. + + + -n, --multiple nb_data_sets + nb_data_sets is an integer corresponding to the number of data sets to analyse. + + -p, --pars + Use a minimum parsimony starting tree. This option is taken into account when the '-u' option + is absent and when tree topology modifications are to be done. + + -b, --bootstrap int + + - *int > 0*: int is the number of bootstrap replicates. + - *int = 0*: neither approximate likelihood ratio test nor bootstrap values are computed. + - *int = -1*: approximate likelihood ratio test returning aLRT statistics. + - *int = -2*: approximate likelihood ratio test returning Chi2-based parametric branch supports. + - *int = -4*: (default) SH-like branch supports alone. + - *int = -5*: approximate Bayes branch supports. + -m, --model model + model : substitution model name. + + - Nucleotide-based models : HKY85 (default) | JC69 | K80 | F81 | F84 | TN93 | GTR | custom(*) + + (*) : *for the custom option, a string of six digits identifies the model. For instance, 00000 corresponds to F81, JC69 provided the distribution of nucleotide frequencies is uniform). 012345 corresponds to GTR. This option can be used for encoding any model that is a nested within GTR.* + + * Amino-acid based models : LG (default) | WAG | JTT | MtREV | Dayhoff | DCMut | RtREV | CpREV | VT + Blosum62 | MtMam | MtArt | HIVw | HIVb | custom(**) + + (**) **--aa_rate_file** *filename* file that provides the amino acid substitution rate matrix in PAML format. + It is compulsory to use this option when analysing amino acid sequences with the "custom" model. + + -f frequency + - *"e"*: the character frequencies are determined as follows : + - Nucleotide sequences: (Empirical) the equilibrium base frequencies are estimated by counting the occurence of the different bases in the alignment. + - Amino-acid sequences: (Empirical) the equilibrium amino-acid frequencies are estimated by counting the occurence of the different amino-acids in the alignment. + - *"m"* : the character frequencies are determined as follows : + - Nucleotide sequences: (ML) the equilibrium base frequencies are estimated using maximum likelihood + - Amino-acid sequences: (Model) the equilibrium amino-acid frequencies are estimated using the frequencies defined by the substitution model. + - *"fA,fC,fG,fT"*: only valid for nucleotide-based models. fA, fC, fG and fT are floating numbers that correspond to the frequencies of A, C, G and T respectively *(WARNING: do not use any blank space between your values of nucleotide frequencies, only commas!)*. + + -t ts_tv_ratio + ts_tv_ratio : transition/transversion ratio. DNA sequences only. + Can be a fixed positive value (ex:4.0) or e to get the maximum likelihood estimate. + + -v, --pinv prop_invar + prop_invar : proportion of invariable sites. + Can be a fixed value in the [0,1] range or e to get the maximum likelihood estimate. + + -c, --nclasses nb_subst_cat + nb_subst_cat : number of relative substitution rate categories. Default : nb_subst_cat=4. + Must be a positive integer. + + -a, --alpha gamma + gamma : distribution of the gamma distribution shape parameter. + Can be a fixed positive value or e to get the maximum likelihood estimate. + + -s, --search move + Tree topology search operation option. + Can be either NNI (default, fast) or SPR (a bit slower than NNI) or BEST (best of NNI and SPR search). + + -u, --inputtree user_tree_file + user_tree_file : starting tree filename. The tree must be in Newick format. + + -o params + This option focuses on specific parameter optimisation. + + - *tlr* : tree topology (t), branch length (l) and rate parameters (r) are optimised. + - *tl* : tree topology and branch length are optimised. + - *r* : branch length and rate parameters are optimised. + - *l* : branch length are optimised. + - *r* : rate parameters are optimised. + - *n* : no parameter is optimised. + --rand_start This option sets the initial tree to random. + It is only valid if SPR searches are to be performed. + --n_rand_starts integer + Number of initial random trees to be used. + It is only valid if SPR searches are to be performed. + --r_seed integer + Number of the seed used to initiate the random number generator. + --print_site_lnl + Print the likelihood for each site in file *\*_phyml_lk.txt* + --print_trace + Print each phylogeny explored during the tree search process in file *\*_phyml_trace.txt*. + --run_id ID_string + Append the string ID_string at the end of each PhyML output file. + This option may be useful when running simulations involving PhyML. + --quiet + No interactive question (for running in batch mode) and quiet output. + --alias_subpatt + Site aliasing is generalized at the subtree level. Sometimes lead to faster calculations. + See Kosakovsky Pond SL, Muse SV, Sytematic Biology (2004) for an example. + --boot_progress_display num (default=20) + num is the frequency at which the bootstrap progress bar will be updated. + Must be an integer. + ]]> + </help> + <citations> + <citation type="doi">10.1093/sysbio/syq010</citation> + </citations> +</tool>
--- a/phyml_oneclick/phyml_oneclick.xml Thu Jan 26 04:40:00 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,345 +0,0 @@ -<tool id="phyml_oneclick" name="PhyML Oneclick" version="3.0_360-500M"> - <description>Phylogeny software based on the maximum-likelihood</description> - <edam_operations> - <edam_operation>operation_0540</edam_operation> - <edam_operation>operation_0324</edam_operation> - </edam_operations> - <requirements> - <requirement type="package" version="3.0_360-500M">phyml</requirement> - </requirements> - <version_command> - <![CDATA[ phyml --version ]]> - </version_command> - <stdio> - <regex match="*" - source="stdrr" - level="fatal"/> - </stdio> - <command> - <![CDATA[ - ##PhyML outputs are based on input path and we need to create outputs in working_dir. - ln -sf $input '${input.name}'; - #if ($usetree.inputTree == "true"): - ln -sf ${$usetree.userInputTree} ${$usetree.userInputTree.name}; - #end if - - phyml --input '${input.name}' - ${phylip_format} - - #if $seq.type_of_seq == "cfg" - - ## Read information of sequence type - ## read an info file to choose which option set and set a model by default - #set $info = open( str($input_info) ).read() - - #if 'dna' in $info: - --datatype nt - --model HKY85 - -f e - - #else if 'protein' in $info: - --datatype aa - --model WAG - -f m - - #end if - #else - --datatype ${seq.type_of_seq} - --model ${seq.model} - -f ${equi_freq} - - #end if - - --multiple ${nb_data_set} - - #if (str($support_condition.branchSupport) in ['0','-1','-2','-4','-5']): - --bootstrap ${support_condition.branchSupport} - #else: - --bootstrap ${support_condition.branchSupport.replicate} - #end if - - #if ($seq.type_of_seq == "nt"): - -t ${seq.tstv} - #end if - - - --pinv ${prop_invar} - - --nclasses ${nbSubstCat} - - #if (str($nbSubstCat) != "1"): - --alpha ${gamma} - #end if - - --search ${move} - -o ${optimisationTopology} - - #if ($usetree.inputTree == "true"): - --inputtree ${$usetree.userInputTree.name} - #end if - - #if ($numStartSeed != "0"): - --r_seed ${numStartSeed} - #end if - - > ${output_stdout}; - grep 'failed' ${output_stdout} >&2; - ]]> - </command> - <inputs> - <param name="input" type="data" format="phylip, phy" label="Alignment file" help="phylip format"/> - <param name="phylip_format" type="select" label="Changes interleaved format" display="radio"> - <option value="">Interleaved</option> - <option value="--sequential">Sequential</option> - </param> - <param name="nb_data_set" type="integer" min="1" value="1" label="Number of data sets" /> - <conditional name="seq"> - <param name="type_of_seq" type="select" label="Data type" display="radio"> - <option value="nt">Nucleic acids</option> - <option value="aa">Amino acids</option> - <option value="cfg">Type information file</option> - </param> - <when value="nt"> - <param name="tstv" type="text" value="e" label="Transition/transversion ratio" help="Must be a positive integer, 'e' if you want PhyML to estimate it" /> - <param name="model" type="select" label="Substitution model"> - <option value="HKY85">HKY85</option> - <option value="JC69">JC69</option> - <option value="K80">K80</option> - <option value="F81">F81</option> - <option value="F84">F84</option> - <option value="TN93">TN93</option> - <option value="GTR">GTR</option> - </param> - </when> - <when value="aa"> - <param name="model" type="select" label="Evolution model"> - <option value="LG">LG</option> - <option value="WAG">WAG</option> - <option value="JTT">JTT</option> - <option value="MtREV">MtREV</option> - <option value="Dayhoff">Dayhoff</option> - <option value="DCMut">DCMut</option> - <option value="RtREV">RtREV</option> - <option value="CpREV">CpREV</option> - <option value="VT">VT</option> - <option value="Blosum62">Blosum62</option> - <option value="MtMam">MtMam</option> - <option value="MtArt">MtArt</option> - <option value="HIVw">HIVw</option> - <option value="HIVb">HIVb</option> - </param> - </when> - <when value="cfg"> - <param name="input_info" format="txt" type="data" multiple="false" label="Config file" help="Precompute file containning sequence description (dna or protein)"/> - </when> - </conditional> - <param name="prop_invar" type="text" value="e" label="Proportion of invariant sites" help="Can be a fixed value in the [0,1] range or 'e' to get the maximum likelihood estimate, 0 to ignore this parameter"/> - <param name="equi_freq" type="select" label="Equilibrium frequencies" help="Empirical: frequencies are estimated by counting the occurences in the alignment. ML/Model: frequencies are estimated using ML for nucleotides or defined by the proteic substitution model."> - <option value="m">ML/Model</option> - <option value="e">Empirical</option> - </param> - <param name="nbSubstCat" type="integer" min="1" value="4" label="Number of categories for the discrete gamma model" help="1 means no gamma model" /> - <param name="gamma" type="text" value="e" label="Parameter of the gamma model" help="'e' if you want PhyML to estimate it"/> - <param name="move" type="select" label="Tree topology search" display="radio"> - <option value="NNI">NNI (Nearest Neighbor Interchange)</option> - <option value="SPR">SPR (Subtree Pruning and Regraphing)</option> - <option value="BEST">Best of NNI and SPR</option> - </param> - <param name="optimisationTopology" type="select" label="Optimise topology"> - <option value="tlr">Tree topology, Branch length, Rate parameter</option> - <option value="tl">Tree topology, Branch length</option> - <option value="l">Branch length</option> - <option value="r">Rate parameter</option> - <option value="n">No parameter is optimized</option> - </param> - <conditional name="support_condition"> - <param name="branchSupport" type="select" label="Statistical tests for branch support" help="Use aLRT or aBayes to save computing time"> - <option value="0">No bootstrap</option> - <option value="1">Bootstrap</option> - <option value="-1">likelihood aLRT statistics</option> - <option value="-2">likelihood Chi2-based</option> - <option value="-4" selected='true'>SH-like</option> - <option value="-5">Approximate Bayes branch supports</option> - </param> - <when value="0"/> - <when value="-1"/> - <when value="-2"/> - <when value="-4"/> - <when value="-5"/> - <when value="1"> - <param name="replicate" type="integer" min="1" value="100" label="Number of bootstrap replicates" help="Must be a positive integer" /> - </when> - </conditional> - <param name="numStartSeed" type="integer" value="0" label="Number of seed used to initiate the random number generator" help="0 to random seed"/> - <conditional name="usetree"> - <param name="inputTree" type="boolean" truevalue="true" falsevalue="false" checked="False" label="Use input tree guide" /> - <when value="true"> - <param name="userInputTree" type="data" label="Tree file" help="newick format"/> - </when> - <when value="false"/> - </conditional> - </inputs> - <outputs> - <data name="output_tree" format="nhx" label="PhyML Newick tree: ${input.name}.nwk" from_work_dir="*_phyml_tree.txt" /> - <data name="output_stats" format="txt" label="PhyML Statistic: ${input.name}.stats.txt" from_work_dir="*_phyml_stats.txt"/> - <data name="output_stdout" format="txt" label="PhyML Stdout: ${input.name}"/> - </outputs> - <tests> - <test> - <param name="input" value="phylip" /> - <param name="prop_invar" value="0"/> - <param name="type_of_seq" value="nt" /> - <param name="numStartSeed" value="1458308600" /> - <output name="output_tree" file="phylip_phyml_tree.txt" /> - <output name="output_stats" file="phylip_phyml_stats.txt" lines_diff="4"/> - </test> - </tests> - <help> - <![CDATA[ -.. class:: infomark - -**PhyML version 3.0 ** - ------ - -######### -PhyML 3.0 -######### - -A simple, fast, and accurate algorithm to estimate -large phylogenies by maximum likelihood'' - -========== - Overview: -========== - -PhyML is a phylogeny software based on the maximum-likelihood principle. Early PhyML versions used a fast algorithm to perform Nearest Neighbor Interchanges (NNIs), in order to improve a reasonable starting tree topology. Since the original publication (Guindon and Gascuel 2003), PhyML has been widely used due to its simplicity and a fair accuracy/speed compromise. In the mean time research around PhyML has continued. - -We designed an efficient algorithm to search the tree space using Subtree Pruning and Regrafting (SPR) topological moves (Hordijk and Gascuel 2005), and proposed a fast branch test based on an approximate likelihood ratio test (Anisimova and Gascuel 2006). However, these novelties were not included in the official version of PhyML, and we found that improvements were still needed in order to make them effective in some practical cases. PhyML 3.0 achieves this task. - -It implements new algorithms to search the space of tree topologies with user-defined intensity. A non-parametric, Shimodaira-Hasegawa-like branch test is also available. The program provides a number of new evolutionary models and its interface was entirely re-designed. We tested PhyML 3.0 on a large collection of real data sets to ensure that the new version is stable, ready-to-use and still reasonably fast and accurate. - ------ - - -For further informations, please visite the PhyML_ website. - -.. _PhyML: http://www.atgc-montpellier.fr/phyml/ - -Please cite this paper if you use this software in your publications. - - ------ - -OPTIONS -======= - - - -i, --input seq_file_name - seq_file_name is the name of the nucleotide or amino-acid sequence file in PHYLIP format. - - -d, --datatype data_type - data_type is 'nt' for nucleotide (default), 'aa' for amino-acid sequences, or 'generic', - (use NEXUS file format and the 'symbols' parameter here). - - -q, --sequential - Changes interleaved format (default) to sequential format. - - - -n, --multiple nb_data_sets - nb_data_sets is an integer corresponding to the number of data sets to analyse. - - -p, --pars - Use a minimum parsimony starting tree. This option is taken into account when the '-u' option - is absent and when tree topology modifications are to be done. - - -b, --bootstrap int - - - *int > 0*: int is the number of bootstrap replicates. - - *int = 0*: neither approximate likelihood ratio test nor bootstrap values are computed. - - *int = -1*: approximate likelihood ratio test returning aLRT statistics. - - *int = -2*: approximate likelihood ratio test returning Chi2-based parametric branch supports. - - *int = -4*: (default) SH-like branch supports alone. - - *int = -5*: approximate Bayes branch supports. - -m, --model model - model : substitution model name. - - - Nucleotide-based models : HKY85 (default) | JC69 | K80 | F81 | F84 | TN93 | GTR | custom(*) - - (*) : *for the custom option, a string of six digits identifies the model. For instance, 00000 corresponds to F81, JC69 provided the distribution of nucleotide frequencies is uniform). 012345 corresponds to GTR. This option can be used for encoding any model that is a nested within GTR.* - - * Amino-acid based models : LG (default) | WAG | JTT | MtREV | Dayhoff | DCMut | RtREV | CpREV | VT - Blosum62 | MtMam | MtArt | HIVw | HIVb | custom(**) - - (**) **--aa_rate_file** *filename* file that provides the amino acid substitution rate matrix in PAML format. - It is compulsory to use this option when analysing amino acid sequences with the "custom" model. - - -f frequency - - *"e"*: the character frequencies are determined as follows : - - Nucleotide sequences: (Empirical) the equilibrium base frequencies are estimated by counting the occurence of the different bases in the alignment. - - Amino-acid sequences: (Empirical) the equilibrium amino-acid frequencies are estimated by counting the occurence of the different amino-acids in the alignment. - - *"m"* : the character frequencies are determined as follows : - - Nucleotide sequences: (ML) the equilibrium base frequencies are estimated using maximum likelihood - - Amino-acid sequences: (Model) the equilibrium amino-acid frequencies are estimated using the frequencies defined by the substitution model. - - *"fA,fC,fG,fT"*: only valid for nucleotide-based models. fA, fC, fG and fT are floating numbers that correspond to the frequencies of A, C, G and T respectively *(WARNING: do not use any blank space between your values of nucleotide frequencies, only commas!)*. - - -t ts_tv_ratio - ts_tv_ratio : transition/transversion ratio. DNA sequences only. - Can be a fixed positive value (ex:4.0) or e to get the maximum likelihood estimate. - - -v, --pinv prop_invar - prop_invar : proportion of invariable sites. - Can be a fixed value in the [0,1] range or e to get the maximum likelihood estimate. - - -c, --nclasses nb_subst_cat - nb_subst_cat : number of relative substitution rate categories. Default : nb_subst_cat=4. - Must be a positive integer. - - -a, --alpha gamma - gamma : distribution of the gamma distribution shape parameter. - Can be a fixed positive value or e to get the maximum likelihood estimate. - - -s, --search move - Tree topology search operation option. - Can be either NNI (default, fast) or SPR (a bit slower than NNI) or BEST (best of NNI and SPR search). - - -u, --inputtree user_tree_file - user_tree_file : starting tree filename. The tree must be in Newick format. - - -o params - This option focuses on specific parameter optimisation. - - - *tlr* : tree topology (t), branch length (l) and rate parameters (r) are optimised. - - *tl* : tree topology and branch length are optimised. - - *r* : branch length and rate parameters are optimised. - - *l* : branch length are optimised. - - *r* : rate parameters are optimised. - - *n* : no parameter is optimised. - --rand_start This option sets the initial tree to random. - It is only valid if SPR searches are to be performed. - --n_rand_starts integer - Number of initial random trees to be used. - It is only valid if SPR searches are to be performed. - --r_seed integer - Number of the seed used to initiate the random number generator. - --print_site_lnl - Print the likelihood for each site in file *\*_phyml_lk.txt* - --print_trace - Print each phylogeny explored during the tree search process in file *\*_phyml_trace.txt*. - --run_id ID_string - Append the string ID_string at the end of each PhyML output file. - This option may be useful when running simulations involving PhyML. - --quiet - No interactive question (for running in batch mode) and quiet output. - --alias_subpatt - Site aliasing is generalized at the subtree level. Sometimes lead to faster calculations. - See Kosakovsky Pond SL, Muse SV, Sytematic Biology (2004) for an example. - --boot_progress_display num (default=20) - num is the frequency at which the bootstrap progress bar will be updated. - Must be an integer. - ]]> - </help> - <citations> - <citation type="doi">10.1093/sysbio/syq010</citation> - </citations> -</tool>
--- a/repository_dependencies.xml Thu Jan 26 04:40:00 2017 -0500 +++ b/repository_dependencies.xml Thu Jan 26 10:05:45 2017 -0500 @@ -1,10 +1,12 @@ <?xml version="1.0"?> <repositories description="Phylogenetics Tools"> - <repository changeset_revision="8675ec79383b" name="fastme" owner="gandres" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + <repository changeset_revision="2a218f19a2a0" name="clustalo" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + <repository changeset_revision="dd4a533a0e3c" name="mafft" owner="rnateam" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + <repository changeset_revision="d336126a545f" name="muscle" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> <repository changeset_revision="452127bcb1cf" name="noisy" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> <repository changeset_revision="814b453382cf" name="gblocks" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + <repository changeset_revision="8675ec79383b" name="fastme" owner="gandres" toolshed="https://testtoolshed.g2.bx.psu.edu" /> <repository changeset_revision="b347bcd7304e" name="phyml_sms_1_3" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> <repository changeset_revision="bb8875d6dc35" name="phyml" owner="dereeper" toolshed="https://testtoolshed.g2.bx.psu.edu" /> - <repository changeset_revision="dd4a533a0e3c" name="mafft" owner="rnateam" toolshed="https://testtoolshed.g2.bx.psu.edu" /> <repository changeset_revision="ceba45fbfcb8" name="newick_display" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </repositories>
--- a/tool_dependencies.xml Thu Jan 26 04:40:00 2017 -0500 +++ b/tool_dependencies.xml Thu Jan 26 10:05:45 2017 -0500 @@ -1,14 +1,14 @@ <?xml version="1.0"?> <tool_dependency> - <package name="clustalo" version="1.2.1"> - <repository changeset_revision="8e1916ccca9a" name="package_clustalo_1_2_1" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + <package name="fastme" version="2.1.5"> + <repository changeset_revision="eb335631f256" name="package_fastme_2_1_5" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </package> <package name="gblocks" version="0.91b"> <repository changeset_revision="cc74017fbc04" name="package_gblocks_0_91b" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </package> - <package name="muscle" version="3.8.31"> - <repository changeset_revision="17c53de3f872" name="package_muscle_3_8_31" owner="iuc" toolshed="https://testtoolshed.g2.bx.psu.edu" /> - </package> + <package name="noisy" version="1.5.12"> + <repository changeset_revision="8721ee950525" name="package_noisy_1_5_12" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> + </package> <package name="phyml-sms" version="1.3"> <repository changeset_revision="244d490a5cf5" name="package_phyml_sms_1_3" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </package> @@ -18,13 +18,7 @@ <package name="phyml" version="3.0_360-500M"> <repository changeset_revision="ee4abcc34037" name="package_phyml_3_0" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </package> - <package name="R" version="3.2.1"> + <package name="R" version="3.0.1"> <repository changeset_revision="55b8ae401f5c" name="package_r_3_0_1" owner="iuc" toolshed="https://testtoolshed.g2.bx.psu.edu" /> </package> - <package name="noisy" version="1.5.12"> - <repository changeset_revision="8721ee950525" name="package_noisy_1_5_12" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> - </package> - <package name="fastme" version="2.1.5"> - <repository changeset_revision="eb335631f256" name="package_fastme_2_1_5" owner="dcorreia" toolshed="https://testtoolshed.g2.bx.psu.edu" /> - </package> </tool_dependency>