Mercurial > repos > peterjc > seq_select_by_id

view test-data/k12_hypothetical.fasta @ 12:9e9e3b860aa0 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
Uploaded v0.0.7e, depend on Biopython 1.62, tabs to spaces in XML
author peterjc
date Fri, 27 Sep 2013 06:14:51 -0400
parents cfae9b16ab65
children
line wrap: on
line source

>gi|16127999|ref|NP_414546.1| hypothetical protein b0005 [Escherichia coli str. K-12 substr. MG1655]
MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHL
HGPPPPPRHHKKAPHDHHGGHGPGKHHR