Mercurial > repos > peterjc > ncbi_blast_plus

diff test-data/tblastn_four_human_vs_rhodopsin.html @ 38:2f7fac29bb3c draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
Uploaded v0.1.00 preview 1, updated to wrap BLAST+ 2.2.29
author peterjc
date Wed, 15 Jan 2014 05:38:14 -0500
parents 5402f9b0d508
children b19b6addd05c
line wrap: on
line diff
--- a/test-data/tblastn_four_human_vs_rhodopsin.html	Tue Dec 03 10:02:17 2013 -0500
+++ b/test-data/tblastn_four_human_vs_rhodopsin.html	Wed Jan 15 05:38:14 2014 -0500
@@ -3,7 +3,7 @@
 <BODY BGCOLOR="#FFFFFF" LINK="#0000FF" VLINK="#660099" ALINK="#660099">
 <PRE>
 
-<b>TBLASTN 2.2.28+</b>
+<b>TBLASTN 2.2.29+</b>
 
 
 <b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44
@@ -461,8 +461,8 @@
 
 Length=1047
 
-<script src="blastResult.js"></script>
- Score =  732 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
+
+ Score =   732 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
  Identities = 336/348 (97%), Positives = 343/348 (99%), Gaps = 0/348 (0%)
  Frame = +1
 
@@ -511,8 +511,8 @@
 
 Length=1574
 
-<script src="blastResult.js"></script>
- Score =  646 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
+
+ Score =   646 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
  Identities = 290/342 (85%), Positives = 320/342 (94%), Gaps = 1/342 (0%)
  Frame = +3
 
@@ -561,8 +561,8 @@
 
 Length=4301
 
-<script src="blastResult.js"></script>
- Score =  151 bits (342),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
+
+ Score =   151 bits (342),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
  Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
  Frame = +3
 
@@ -575,7 +575,7 @@
 Sbjct  3327  SIYNPVIYIMMNKQ  3368
 
 
- Score =  126 bits (284),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
+ Score =   126 bits (284),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
  Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
  Frame = +2
 
@@ -584,7 +584,7 @@
 Sbjct  2855  RYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEVRS  3031
 
 
- Score =  229 bits (523),  Expect = 9e-67, Method: Compositional matrix adjust.
+ Score =   229 bits (523),  Expect = 9e-67, Method: Compositional matrix adjust.
  Identities = 107/111 (96%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
  Frame = +1
 
@@ -597,7 +597,7 @@
 Sbjct  181  PLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGG  333
 
 
- Score =  122 bits (276),  Expect = 1e-32, Method: Compositional matrix adjust.
+ Score =   122 bits (276),  Expect = 1e-32, Method: Compositional matrix adjust.
  Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
  Frame = +3
 
@@ -635,8 +635,8 @@
 
 Length=983
 
-<script src="blastResult.js"></script>
- Score =  658 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
+
+ Score =   658 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
  Identities = 310/326 (95%), Positives = 322/326 (99%), Gaps = 0/326 (0%)
  Frame = +1
 
@@ -685,8 +685,8 @@
 
 Length=1047
 
-<script src="blastResult.js"></script>
- Score =  711 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
+
+ Score =   711 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
  Identities = 325/348 (93%), Positives = 337/348 (97%), Gaps = 0/348 (0%)
  Frame = +1
 
@@ -735,8 +735,8 @@
 
 Length=1344
 
-<script src="blastResult.js"></script>
- Score =  626 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
+
+ Score =   626 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
  Identities = 281/342 (82%), Positives = 311/342 (91%), Gaps = 1/342 (0%)
  Frame = +2