Mercurial > repos > matthias > longorf

diff test-data/test_output.fasta @ 0:e09750baa9ac draft default tip

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload for repository https://github.com/bernt-matthias/mb-galaxy-tools/blob/master/tools/longorf/ commit 8e118a4d24047e2c62912b962e854f789d6ff559-dirty
author matthias
date Wed, 20 Jun 2018 10:55:21 -0400
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/test_output.fasta	Wed Jun 20 10:55:21 2018 -0400
@@ -0,0 +1,4 @@
+>14520830-14521117(-)_27 [462 - 178] (REVERSE SENSE)
+VSEHRSIIPTYVRGTALHLANRNCNCHRQGIHPDRRKIKPNPTASQNSLLAEIFSRGFVPRNLEWKKNQVVQLSRIDSSVLFLFPVLTCFACWFC
+>103089310-103089560(-)_22 [443 - 132] (REVERSE SENSE)
+HTDDFKSVTSHSGAIYMQFSLILPLFSSNTDSITILDHLQRVQIHKTKTSIYDNKIFRNFSDVPPTLCSTLRLFPFPRVSRYTDIRMILKVSQATVEPYTCSSA
\ No newline at end of file