Mercurial > repos > matthias > longorf
diff getLongestORF.py @ 0:e09750baa9ac draft default tip
planemo upload for repository https://github.com/bernt-matthias/mb-galaxy-tools/blob/master/tools/longorf/ commit 8e118a4d24047e2c62912b962e854f789d6ff559-dirty
| author | matthias | 
|---|---|
| date | Wed, 20 Jun 2018 10:55:21 -0400 | 
| parents | |
| children | 
line wrap: on
 line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/getLongestORF.py Wed Jun 20 10:55:21 2018 -0400 @@ -0,0 +1,114 @@ +#!/usr/bin/env python + +""" +usage: getLongestORF.py input output.fas output.tab + + +input.fas: a amino acid fasta file of all open reading frames (ORF) listed by transcript (output of GalaxyTool "getorf") +output.fas: fasta file with all longest ORFs per transcript +output.tab: table with information about seqID, start, end, length, orientation, longest for all ORFs + +example: + +>253936-254394(+)_1 [28 - 63] +LTNYCQMVHNIL +>253936-254394(+)_2 [18 - 77] +HKLIDKLLPNGAQYFVKSTQ +>253936-254394(+)_3 [32 - 148] +QTTAKWCTIFCKKYPVAPFHTMYLNYAVTWHHRSLLVAV +>253936-254394(+)_4 [117 - 152] +LGIIVPSLLLCN +>248351-252461(+)_1 [14 - 85] +VLARKYPRCLSPSKKSPCQLRQRS +>248351-252461(+)_2 [21 - 161] +PGNTHDASAHRKSLRVNSDKEVKCLFTKNAASEHPDHKRRRVSEHVP +>248351-252461(+)_3 [89 - 202] +VPLHQECCIGAPRPQTTACVRACAMTNTPRSSMTSKTG +>248351-252461(+)_4 [206 - 259] +SRTTSGRQSVLSEKLWRR +>248351-252461(+)_5 [263 - 313] +CLSPLWVPCCSRHSCHG +""" + +import sys,re + +def findlongestOrf(transcriptDict,old_seqID): + #write for previous seqID + prevTranscript = transcriptDict[old_seqID] + i_max = 0 + #find longest orf in transcript + for i in range(0,len(prevTranscript)): + if(prevTranscript[i][2] >= prevTranscript[i_max][2]): + i_max = i + for i in range(0,len(prevTranscript)): + prevStart = prevTranscript[i][0] + prevEnd = prevTranscript[i][1] + prevLength = prevTranscript[i][2] + output = str(old_seqID) + "\t" + str(prevStart) + "\t" + str(prevEnd) + "\t" + str(prevLength) + if (end - start > 0): + output+="\tForward" + else: + output+="\tReverse" + if(i == i_max): + output += "\ty\n" + else: + output += "\tn\n" + OUTPUT_ORF_SUMMARY.write(output) + transcriptDict.pop(old_seqID, None) + return None + +INPUT = open(sys.argv[1],"r") +OUTPUT_FASTA = open(sys.argv[2],"w") +OUTPUT_ORF_SUMMARY = open(sys.argv[3],"w") + +seqID = "" +old_seqID = "" +lengthDict = {} +seqDict = {} +headerDict = {} +transcriptDict = {} +skip = False + +OUTPUT_ORF_SUMMARY.write("seqID\tstart\tend\tlength\torientation\tlongest\n") + +for line in INPUT: + line = line.strip() +# print line + if(re.match(">",line)): #header + seqID = "_".join(line.split(">")[1].split("_")[:-1]) + #seqID = line.split(">")[1].split("_")[0] + start = int (re.search('\ \[(\d+)\ -', line).group(1)) + end = int (re.search('-\ (\d+)\]',line).group(1)) + length = abs(end - start) + if(seqID not in transcriptDict and old_seqID != ""): #new transcript + findlongestOrf(transcriptDict,old_seqID) + if seqID not in transcriptDict: + transcriptDict[seqID] = [] + transcriptDict[seqID].append([start,end,length]) + if(seqID not in lengthDict and old_seqID != ""): #new transcript + #write FASTA + OUTPUT_FASTA.write(headerDict[old_seqID]+"\n"+seqDict[old_seqID]+"\n") + #delete old dict entry + headerDict.pop(old_seqID, None) + seqDict.pop(old_seqID, None) + lengthDict.pop(old_seqID, None) + #if several longest sequences exist with the same length, the dictionary saves the last occuring. + if(seqID not in lengthDict or length >= lengthDict[seqID]): + headerDict[seqID] = line + lengthDict[seqID] = length + seqDict[seqID] = "" + skip = False + else: + skip = True + next + old_seqID = seqID + elif(skip): + next + else: + seqDict[seqID] += line + +OUTPUT_FASTA.write(headerDict[old_seqID]+"\n"+seqDict[old_seqID]) +findlongestOrf(transcriptDict,old_seqID) +INPUT.close() +OUTPUT_FASTA.close() +OUTPUT_ORF_SUMMARY.close()
