Mercurial > repos > iuc > bakta
comparison bakta.xml @ 2:4abecd4a7d96 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/blob/master/tools/bakta commit 74f8fe2e7de713920026d372b28c73adb04ee97c
| author | iuc |
|---|---|
| date | Wed, 21 Dec 2022 20:59:01 +0000 |
| parents | 3368e3bda790 |
| children | b3edcb5f2a64 |
comparison
equal
deleted
inserted
replaced
| 1:3368e3bda790 | 2:4abecd4a7d96 |
|---|---|
| 9 <expand macro='xrefs'/> | 9 <expand macro='xrefs'/> |
| 10 <expand macro="requirements"/> | 10 <expand macro="requirements"/> |
| 11 <expand macro="version_command"/> | 11 <expand macro="version_command"/> |
| 12 | 12 |
| 13 <command detect_errors="aggressive"><![CDATA[ | 13 <command detect_errors="aggressive"><![CDATA[ |
| 14 mkdir ./database_path && | |
| 15 ln -s '$(input_option.bakta_db_select.fields.path)/'* database_path && | |
| 16 ln -s '$(input_option.amrfinder_db_select.fields.path)' database_path && | |
| 17 | |
| 14 bakta | 18 bakta |
| 15 #*====================================== | 19 #*====================================== |
| 16 CPU option | 20 CPU option |
| 17 ======================================*# | 21 ======================================*# |
| 18 --threads \${GALAXY_SLOTS:-1} | 22 --threads \${GALAXY_SLOTS:-1} |
| 19 #*====================================== | 23 #*====================================== |
| 20 Bakta database | 24 Bakta database |
| 21 ======================================*# | 25 ======================================*# |
| 22 --db $input_option.db_select.fields.path | 26 --db ./database_path |
| 23 #if $input_option.min_contig_length | 27 #if $input_option.min_contig_length |
| 24 --min-contig-length $input_option.min_contig_length | 28 --min-contig-length $input_option.min_contig_length |
| 25 #else if $annotation.compliant | 29 #else if $annotation.compliant |
| 26 --min-contig-length 200 | 30 --min-contig-length 200 |
| 27 #else | 31 #else |
| 69 #*====================================== | 73 #*====================================== |
| 70 Workflow OPTIONS | 74 Workflow OPTIONS |
| 71 skip some step of the bakta analysis | 75 skip some step of the bakta analysis |
| 72 ======================================*# | 76 ======================================*# |
| 73 | 77 |
| 74 #if "skip_trna" in $workflow.skip_analysis | 78 #echo " ".join($workflow.skip_analysis) |
| 75 --skip-trna | |
| 76 #end if | |
| 77 #if "skip_tmrna" in $workflow.skip_analysis | |
| 78 --skip-tmrna | |
| 79 #end if | |
| 80 #if "skip_rrna" in $workflow.skip_analysis | |
| 81 --skip-rrna | |
| 82 #end if | |
| 83 #if "skip_ncrna" in $workflow.skip_analysis | |
| 84 --skip-ncrna | |
| 85 #end if | |
| 86 #if "skip_ncrna_region" in $workflow.skip_analysis | |
| 87 --skip-ncrna-region | |
| 88 #end if | |
| 89 #if "skip_crispr" in $workflow.skip_analysis | |
| 90 --skip-crispr | |
| 91 #end if | |
| 92 #if "skip_cds" in $workflow.skip_analysis | |
| 93 --skip-cds | |
| 94 #end if | |
| 95 #if "skip_sorf" in $workflow.skip_analysis | |
| 96 --skip-sorf | |
| 97 #end if | |
| 98 #if "skip_gap" in $workflow.skip_analysis | |
| 99 --skip-gap | |
| 100 #end if | |
| 101 #if "skip_ori" in $workflow.skip_analysis | |
| 102 --skip-ori | |
| 103 #end if | |
| 104 | 79 |
| 105 #*====================================== | 80 #*====================================== |
| 106 Genome file | 81 Genome file |
| 107 ======================================*# | 82 ======================================*# |
| 108 '$input_option.input_file' | 83 '$input_option.input_file' |
| 112 | tee '$logfile' | 87 | tee '$logfile' |
| 113 ]]></command> | 88 ]]></command> |
| 114 <inputs> | 89 <inputs> |
| 115 <!-- DB and file INPUT --> | 90 <!-- DB and file INPUT --> |
| 116 <section name="input_option" title="Input/Output options" expanded="true"> | 91 <section name="input_option" title="Input/Output options" expanded="true"> |
| 117 <param name="db_select" type="select" label="The bakta database"> | 92 <param name="bakta_db_select" type="select" label="The bakta database"> |
| 118 <options from_data_table="bakta_database"> | 93 <options from_data_table="bakta_database"> |
| 119 <validator message="No bakta database is available" type="no_options"/> | 94 <filter type="static_value" value="@BAKTA_VERSION@" column="bakta_version"/> |
| 95 <validator message="No bakta database is available" type="no_options"/> | |
| 120 </options> | 96 </options> |
| 121 </param> | 97 </param> |
| 98 <param name="amrfinder_db_select" type="select" label="The amrfinderplus database"> | |
| 99 <options from_data_table="amrfinderplus_database"> | |
| 100 <validator message="No amrfinderplus database is available" type="no_options"/> | |
| 101 </options> | |
| 102 </param> | |
| 103 | |
| 122 <param name="input_file" type="data" format="fasta,fasta.gz" label="Select genome in fasta format"/> | 104 <param name="input_file" type="data" format="fasta,fasta.gz" label="Select genome in fasta format"/> |
| 123 <param name="min_contig_length" type="integer" optional="true" min="0" label="Minimum contig size" help="Minimum contig size (default = 1; 200 in compliant mode) (--min-contig-length)"/> | 105 <param name="min_contig_length" type="integer" optional="true" min="0" label="Minimum contig size" help="Minimum contig size (default = 1; 200 in compliant mode) (--min-contig-length)"/> |
| 124 </section> | 106 </section> |
| 125 <!-- Organism INFORMATION OPTIONS --> | 107 <!-- Organism INFORMATION OPTIONS --> |
| 126 <section name="organism" title="Optional organism options" expanded="false"> | 108 <section name="organism" title="Optional organism options" expanded="false"> |
| 156 <param argument="--proteins" type="data" format="fasta" optional="true" label="Protein fasta file" help="Fasta file of trusted protein sequences for CDS annotation"/> | 138 <param argument="--proteins" type="data" format="fasta" optional="true" label="Protein fasta file" help="Fasta file of trusted protein sequences for CDS annotation"/> |
| 157 </section> | 139 </section> |
| 158 <!-- PARAMETER FOR WORKFLOW ANALYSIS --> | 140 <!-- PARAMETER FOR WORKFLOW ANALYSIS --> |
| 159 <section name="workflow" title="Workflow option to skip steps"> | 141 <section name="workflow" title="Workflow option to skip steps"> |
| 160 <param name="skip_analysis" type="select" display="checkboxes" multiple="true" label="Select steps to skip"> | 142 <param name="skip_analysis" type="select" display="checkboxes" multiple="true" label="Select steps to skip"> |
| 161 <option value="skip_trna"> Skip tRNA detection and annotation </option> | 143 <option value="--skip-trna"> Skip tRNA detection and annotation </option> |
| 162 <option value="skip_tmrna"> Skip tmRNA detection and annotation </option> | 144 <option value="--skip-tmrna"> Skip tmRNA detection and annotation </option> |
| 163 <option value="skip_rrna"> Skip rRNA detection and annotation </option> | 145 <option value="--skip-rrna"> Skip rRNA detection and annotation </option> |
| 164 <option value="skip_ncrna"> Skip ncRNA detection and annotation </option> | 146 <option value="--skip-ncrna"> Skip ncRNA detection and annotation </option> |
| 165 <option value="skip_ncrna_region"> Skip ncRNA region detection and annotation </option> | 147 <option value="--skip-ncrna-region"> Skip ncRNA region detection and annotation </option> |
| 166 <option value="skip_crispr"> Skip CRISPR array detection and annotation </option> | 148 <option value="--skip-crispr"> Skip CRISPR array detection and annotation </option> |
| 167 <option value="skip_cds"> Skip CDS detection and annotation </option> | 149 <option value="--skip-cds"> Skip CDS detection and annotation </option> |
| 168 <option value="skip_sorf"> Skip sORF detection and annotation </option> | 150 <option value="--skip-pseudo"> Skip pseudogene detection and annotation </option> |
| 169 <option value="skip_gap"> Skip gap detection and annotation </option> | 151 <option value="--skip-sorf"> Skip sORF detection and annotation </option> |
| 170 <option value="skip_ori"> Skip oriC/oriT detection and annotation </option> | 152 <option value="--skip-gap"> Skip gap detection and annotation </option> |
| 153 <option value="--skip-ori"> Skip oriC/oriT detection and annotation </option> | |
| 171 </param> | 154 </param> |
| 172 </section> | 155 </section> |
| 173 <section name="output_files" title="Selection of the output files"> | 156 <section name="output_files" title="Selection of the output files"> |
| 174 <param name="output_selection" type="select" display="checkboxes" multiple="true" label="Output files selection"> | 157 <param name="output_selection" type="select" display="checkboxes" multiple="true" label="Output files selection"> |
| 175 <option value="file_tsv" selected="true"> Annotation file in TSV </option> | 158 <option value="file_tsv" selected="true"> Annotation file in TSV </option> |
| 176 <option value="file_gff3" selected="true"> Annotation and sequence in GFF3 </option> | 159 <option value="file_gff3" selected="true"> Annotation and sequence in GFF3 </option> |
| 177 <option value="file_gbff" selected="true"> Annotations and sequences in GenBank format </option> | 160 <option value="file_gbff" selected="false"> Annotations and sequences in GenBank format </option> |
| 178 <option value="file_embl" selected="true"> Annotations and sequences in EMBL format </option> | 161 <option value="file_embl" selected="false"> Annotations and sequences in EMBL format </option> |
| 179 <option value="file_fna" selected="true"> Replicon/contig DNA sequences as FASTA </option> | 162 <option value="file_fna" selected="false"> Replicon/contig DNA sequences as FASTA </option> |
| 180 <option value="file_ffn" selected="true"> Feature nucleotide sequences as FASTA </option> | 163 <option value="file_ffn" selected="true"> Feature nucleotide sequences as FASTA </option> |
| 181 <option value="file_faa" selected="true"> CDS/sORF amino acid sequences as FASTA </option> | 164 <option value="file_faa" selected="false"> CDS/sORF amino acid sequences as FASTA </option> |
| 182 <option value="hypo_tsv" selected="true"> Hypothetical protein CDS in TSV</option> | 165 <option value="hypo_tsv" selected="false"> Hypothetical protein CDS in TSV</option> |
| 183 <option value="hypo_fa" selected="true"> Hypothetical protein CDS amino sequences as FASTA</option> | 166 <option value="hypo_fa" selected="false"> Hypothetical protein CDS amino sequences as FASTA</option> |
| 184 <option value="sum_txt" selected="true"> Summary as TXT</option> | 167 <option value="sum_txt" selected="false"> Summary as TXT</option> |
| 185 <option value="file_json" selected="true"> Information on each annotated feature as JSON </option> | 168 <option value="file_json" selected="false"> Information on each annotated feature as JSON </option> |
| 186 <option value="log_txt" selected="true"> Log file as TXT </option> | 169 <option value="file_plot" selected="true"> Plot of the annotation result as SVG </option> |
| 170 <option value="log_txt" selected="false"> Log file as TXT </option> | |
| 187 </param> | 171 </param> |
| 188 </section> | 172 </section> |
| 189 | 173 |
| 190 </inputs> | 174 </inputs> |
| 191 <outputs> | 175 <outputs> |
| 192 <data name="annotation_tsv" format="tabular" from_work_dir="bakta_output.tsv" label="${tool.name} on ${on_string}: bakta_output.tsv"> | 176 <data name="annotation_tsv" format="tabular" from_work_dir="bakta_output.tsv" label="${tool.name} on ${on_string}: annotation_summary"> |
| 193 <filter> output_files['output_selection'] and "file_tsv" in output_files['output_selection'] </filter> | 177 <filter> output_files['output_selection'] and "file_tsv" in output_files['output_selection'] </filter> |
| 194 </data> | 178 </data> |
| 195 <data name="annotation_gff3" format="gff3" from_work_dir="bakta_output.gff3" label="${tool.name} on ${on_string}: bakta_output.gff3"> | 179 <data name="annotation_gff3" format="gff3" from_work_dir="bakta_output.gff3" label="${tool.name} on ${on_string}: Annotation_and_sequences"> |
| 196 <filter> output_files['output_selection'] and "file_gff3" in output_files['output_selection'] </filter> | 180 <filter> output_files['output_selection'] and "file_gff3" in output_files['output_selection'] </filter> |
| 197 </data> | 181 </data> |
| 198 <data name="annotation_gbff" format="tabular" from_work_dir="bakta_output.gbff" label="${tool.name} on ${on_string}: bakta_output.gbff"> | 182 <data name="annotation_gbff" format="tabular" from_work_dir="bakta_output.gbff" label="${tool.name} on ${on_string}: bakta_output.gbff"> |
| 199 <filter> output_files['output_selection'] and "file_gbff" in output_files['output_selection'] </filter> | 183 <filter> output_files['output_selection'] and "file_gbff" in output_files['output_selection'] </filter> |
| 200 </data> | 184 </data> |
| 201 <data name="annotation_embl" format="tabular" from_work_dir="bakta_output.embl" label="${tool.name} on ${on_string}: bakta_output.embl"> | 185 <data name="annotation_embl" format="tabular" from_work_dir="bakta_output.embl" label="${tool.name} on ${on_string}: bakta_output.embl"> |
| 202 <filter> output_files['output_selection'] and "file_embl" in output_files['output_selection'] </filter> | 186 <filter> output_files['output_selection'] and "file_embl" in output_files['output_selection'] </filter> |
| 203 </data> | 187 </data> |
| 204 <data name="annotation_fna" format="fasta" from_work_dir="bakta_output.fna" label="${tool.name} on ${on_string}: bakta_output.fna"> | 188 <data name="annotation_fna" format="fasta" from_work_dir="bakta_output.fna" label="${tool.name} on ${on_string}: Contig_sequences"> |
| 205 <filter> output_files['output_selection'] and "file_fna" in output_files['output_selection'] </filter> | 189 <filter> output_files['output_selection'] and "file_fna" in output_files['output_selection'] </filter> |
| 206 </data> | 190 </data> |
| 207 <data name="annotation_ffn" format="fasta" from_work_dir="bakta_output.ffn" label="${tool.name} on ${on_string}: bakta_output.ffn"> | 191 <data name="annotation_ffn" format="fasta" from_work_dir="bakta_output.ffn" label="${tool.name} on ${on_string}: Nucleotide_sequences"> |
| 208 <filter> output_files['output_selection'] and "file_ffn" in output_files['output_selection'] </filter> | 192 <filter> output_files['output_selection'] and "file_ffn" in output_files['output_selection'] </filter> |
| 209 </data> | 193 </data> |
| 210 <data name="annotation_faa" format="fasta" from_work_dir="bakta_output.faa" label="${tool.name} on ${on_string}: bakta_output.faa"> | 194 <data name="annotation_faa" format="fasta" from_work_dir="bakta_output.faa" label="${tool.name} on ${on_string}: Amino_acid_sequences"> |
| 211 <filter> output_files['output_selection'] and "file_faa" in output_files['output_selection'] </filter> | 195 <filter> output_files['output_selection'] and "file_faa" in output_files['output_selection'] </filter> |
| 212 </data> | 196 </data> |
| 213 <data name="hypotheticals_tsv" format="tabular" from_work_dir="bakta_output.hypotheticals.tsv" label="${tool.name} on ${on_string}: bakta_output.hypotheticals.tsv"> | 197 <data name="hypotheticals_tsv" format="tabular" from_work_dir="bakta_output.hypotheticals.tsv" label="${tool.name} on ${on_string}: hypothetical_annotation_summary"> |
| 214 <filter> output_files['output_selection'] and "hypo_tsv" in output_files['output_selection'] </filter> | 198 <filter> output_files['output_selection'] and "hypo_tsv" in output_files['output_selection'] </filter> |
| 215 </data> | 199 </data> |
| 216 <data name="hypotheticals_faa" format="fasta" from_work_dir="bakta_output.hypotheticals.faa" label="${tool.name} on ${on_string}: bakta_output.hypotheticals.faa"> | 200 <data name="hypotheticals_faa" format="fasta" from_work_dir="bakta_output.hypotheticals.faa" label="${tool.name} on ${on_string}: hypothetical_amino_acid_sequences"> |
| 217 <filter> output_files['output_selection'] and "hypo_fa" in output_files['output_selection'] </filter> | 201 <filter> output_files['output_selection'] and "hypo_fa" in output_files['output_selection'] </filter> |
| 218 </data> | 202 </data> |
| 219 <data name="summary_txt" format="txt" from_work_dir="bakta_output.txt" label="${tool.name} on ${on_string}: bakta_summary.txt"> | 203 <data name="summary_txt" format="txt" from_work_dir="bakta_output.txt" label="${tool.name} on ${on_string}: Analysis_summary"> |
| 220 <filter> output_files['output_selection'] and "sum_txt" in output_files['output_selection'] </filter> | 204 <filter> output_files['output_selection'] and "sum_txt" in output_files['output_selection'] </filter> |
| 221 </data> | 205 </data> |
| 222 <data name="annotation_json" format="json" from_work_dir="bakta_output.json" label="${tool.name} on ${on_string}: bakta_output.json"> | 206 <data name="annotation_json" format="json" from_work_dir="bakta_output.json" label="${tool.name} on ${on_string}: annotation_machine_readable"> |
| 223 <filter> output_files['output_selection'] and "file_json" in output_files['output_selection'] </filter> | 207 <filter> output_files['output_selection'] and "file_json" in output_files['output_selection'] </filter> |
| 208 </data> | |
| 209 <data name="annotation_plot" format="svg" from_work_dir="bakta_output.svg" label="${tool.name} on ${on_string}: Plot of the annotation"> | |
| 210 <filter> output_files['output_selection'] and "file_plot" in output_files['output_selection'] </filter> | |
| 224 </data> | 211 </data> |
| 225 <data name="logfile" format="txt" label="${tool.name} on ${on_string}: log file"> | 212 <data name="logfile" format="txt" label="${tool.name} on ${on_string}: log file"> |
| 226 <filter> output_files['output_selection'] and "log_txt" in output_files['output_selection'] </filter> | 213 <filter> output_files['output_selection'] and "log_txt" in output_files['output_selection'] </filter> |
| 227 </data> | 214 </data> |
| 228 </outputs> | 215 </outputs> |
| 229 | |
| 230 <tests> | 216 <tests> |
| 231 <test expect_num_outputs="12"> <!-- TEST_1 database + input --> | 217 <test expect_num_outputs="13"> <!-- TEST_1 database + input --> |
| 232 <section name="input_option" > | 218 <section name="input_option" > |
| 233 <param name="db_select" value="test-db-bakta"/> | 219 <param name="bakta_db_select" value="V0.1_2022-08-29"/> |
| 234 <param name="input_file" value="NC_002127.1.fna"/> | 220 <param name="amrfinder_db_select" value="V3.6-2020-03-20.1"/> |
| 235 </section> | 221 <param name="input_file" value="NC_002127.1.fna"/> |
| 236 <output name="logfile" value="TEST_1/TEST_1.log" lines_diff="10"> | 222 <param name="min_contig_length" value="250"/> |
| 237 <assert_contents> | 223 </section> |
| 238 <has_text_matching n="1" expression="Genome size: 1,330 bp"/> | 224 <section name="output_files"> |
| 239 <has_n_lines n="94" delta="1"/> | 225 <param name="output_selection" value="file_tsv,file_gff3,file_gbff,file_embl,file_fna,file_ffn,file_faa,hypo_tsv,hypo_fa,sum_txt,file_json,file_plot,log_txt"/> |
| 240 </assert_contents> | 226 </section> |
| 241 </output> | 227 <output name="annotation_tsv" value="TEST_1/TEST_1.tsv" lines_diff="2"/> |
| 242 <output name="annotation_tsv" value="TEST_1/TEST_1.tsv" lines_diff="1"/> | 228 <output name="annotation_gff3" value="TEST_1/TEST_1.gff3" lines_diff="2"/> |
| 243 <output name="annotation_gff3" value="TEST_1/TEST_1.gff3" lines_diff="2"> | 229 <output name="annotation_gbff" value="TEST_1/TEST_1.gbff" lines_diff="8"/> |
| 244 <assert_contents> | 230 <output name="annotation_embl" value="TEST_1/TEST_1.embl" lines_diff="6"/> |
| 245 <has_text_matching expression="TTCTTCTGCGAGTTCGTGCAGCTTCTCACACATGGTGGCCTGCTCGTCAGCATCGAGTGC"/> | 231 <output name="annotation_fna" value="TEST_1/TEST_1.fna"/> |
| 246 </assert_contents> | 232 <output name="annotation_ffn" value="TEST_1/TEST_1.ffn"/> |
| 247 </output> | 233 <output name="annotation_faa" value="TEST_1/TEST_1.faa"/> |
| 248 <output name="annotation_gbff" value="TEST_1/TEST_1.gbff" lines_diff="4"> | 234 <output name="hypotheticals_tsv" value="TEST_1/TEST_1.hypotheticals.tsv" lines_diff="4"/> |
| 249 <assert_contents> | 235 <output name="hypotheticals_faa" value="TEST_1/TEST_1.hypotheticals.faa"/> |
| 250 <has_text_matching expression="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA"/> | 236 <output name="summary_txt" value="TEST_1/TEST_1.txt" lines_diff="4"/> |
| 251 </assert_contents> | 237 <output name="annotation_plot"> |
| 252 </output> | 238 <assert_contents> |
| 253 <output name="annotation_embl" value="TEST_1/TEST_1.embl" lines_diff="2"/> | 239 <has_size value="418991" delta="1000"/> |
| 254 <output name="annotation_fna" value="TEST_1/TEST_1.fna"/> | 240 </assert_contents> |
| 255 <output name="annotation_ffn" value="TEST_1/TEST_1.ffn"/> | 241 </output> |
| 256 <output name="annotation_faa" value="TEST_1/TEST_1.faa"/> | 242 |
| 257 <output name="hypotheticals_tsv" value="TEST_1/TEST_1.hypotheticals.tsv"/> | 243 <output name="annotation_json" value="TEST_1/TEST_1.json" lines_diff="6"/> |
| 258 <output name="hypotheticals_faa" value="TEST_1/TEST_1.hypotheticals.faa"/> | 244 <output name="logfile" value="TEST_1/TEST_1.log" lines_diff="6"/> |
| 259 <output name="summary_txt" value="TEST_1/TEST_1.txt"> | |
| 260 <assert_contents> | |
| 261 <has_text_matching expression="N50: 1330"/> | |
| 262 </assert_contents> | |
| 263 </output> | |
| 264 <output name="annotation_json" value="TEST_1/TEST_1.json" lines_diff="4"> | |
| 265 <assert_contents> | |
| 266 <has_text_matching expression="0.6203007518796992"/> | |
| 267 </assert_contents> | |
| 268 </output> | |
| 269 </test> | |
| 270 <test expect_num_outputs="12"> <!-- TEST_2 another input, add organism info some annotations and skip 2 steps --> | |
| 271 <section name="input_option" > | |
| 272 <param name="db_select" value="test-db-bakta"/> | |
| 273 <param name="input_file" value="NC_002127.1.fna"/> | |
| 274 <param name="min_contig_length" value="250"/> | |
| 275 </section> | |
| 276 <section name="organism"> | |
| 277 <param name="genus" value="Escherichia"/> | |
| 278 <param name="species" value="coli O157:H7"/> | |
| 279 <param name="strain" value="Sakai"/> | |
| 280 <param name="plasmid" value="pOSAK1"/> | |
| 281 </section> | |
| 282 <section name="annotation"> | |
| 283 <param name="--gram" value="-"/> | |
| 284 <param name="keep_contig_headers" value="true"/> | |
| 285 </section> | |
| 286 <section name="workflow"> | |
| 287 <param name="skip_analysis" value="skip_trna,skip_tmrna"/> | |
| 288 </section> | |
| 289 <output name="logfile" value="TEST_2/TEST_2.log" lines_diff="4"> | |
| 290 <assert_contents> | |
| 291 <has_text_matching expression="Genome size: 1,330 bp"/> | |
| 292 </assert_contents> | |
| 293 </output> | |
| 294 <output name="annotation_tsv" value="TEST_2/TEST_2.tsv" lines_diff="2"> | |
| 295 <assert_contents> | |
| 296 <has_text_matching expression="IHHALP_00005"/> | |
| 297 </assert_contents> | |
| 298 </output> | |
| 299 <output name="annotation_gff3" value="TEST_2/TEST_2.gff3" lines_diff="2"> | |
| 300 <assert_contents> | |
| 301 <has_text_matching expression="ID=NC_002127.1;Name=NC_002127.1;Is_circular=true"/> | |
| 302 </assert_contents> | |
| 303 </output> | |
| 304 <output name="annotation_gbff" value="TEST_2/TEST_2.gbff" lines_diff="5"> | |
| 305 <assert_contents> | |
| 306 <has_text_matching expression="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA"/> | |
| 307 </assert_contents> | |
| 308 </output> | |
| 309 <output name="annotation_embl" value="TEST_2/TEST_2.embl" lines_diff="4"> | |
| 310 <assert_contents> | |
| 311 <has_text_matching expression="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA"/> | |
| 312 </assert_contents> | |
| 313 </output> | |
| 314 <output name="annotation_fna" value="TEST_2/TEST_2.fna"/> | |
| 315 <output name="annotation_ffn" value="TEST_2/TEST_2.ffn"/> | |
| 316 <output name="annotation_faa" value="TEST_2/TEST_2.faa"/> | |
| 317 <output name="hypotheticals_tsv" value="TEST_2/TEST_2.hypotheticals.tsv"/> | |
| 318 <output name="hypotheticals_faa" value="TEST_2/TEST_2.hypotheticals.faa"/> | |
| 319 <output name="summary_txt" value="TEST_2/TEST_2.txt"> | |
| 320 <assert_contents> | |
| 321 <has_text_matching expression="N50: 1330"/> | |
| 322 </assert_contents> | |
| 323 </output> | |
| 324 <output name="annotation_json" value="TEST_2/TEST_2.json" lines_diff="4"> | |
| 325 <assert_contents> | |
| 326 <has_text_matching expression="0.4518796992481203"/> | |
| 327 </assert_contents> | |
| 328 </output> | |
| 329 </test> | |
| 330 <test expect_num_outputs="12"> <!-- TEST_3 test all skip steps --> | |
| 331 <section name="input_option" > | |
| 332 <param name="db_select" value="test-db-bakta"/> | |
| 333 <param name="input_file" value="NC_002127.1.fna"/> | |
| 334 <param name="min_contig_length" value="350"/> | |
| 335 </section> | |
| 336 <section name="workflow"> | |
| 337 <param name="skip_analysis" value="skip_trna,skip_tmrna,skip_rrna,skip_ncrna,skip_ncrna_region,skip_crispr,skip_cds,skip_sorf,skip_gap,skip_ori"/> | |
| 338 </section> | |
| 339 <output name="logfile" value="TEST_3/TEST_3.log" lines_diff="4"> | |
| 340 <assert_contents> | |
| 341 <has_text_matching expression="Genome size: 1,330 bp"/> | |
| 342 </assert_contents> | |
| 343 </output> | |
| 344 <output name="annotation_tsv" value="TEST_3/TEST_3.tsv" lines_diff="1"/> | |
| 345 <output name="annotation_gff3" value="TEST_3/TEST_3.gff3" lines_diff="2"/> | |
| 346 <output name="annotation_gbff" value="TEST_3/TEST_3.gbff" lines_diff="10"/> | |
| 347 <output name="annotation_embl" value="TEST_3/TEST_3.embl" lines_diff="4"/> | |
| 348 <output name="annotation_fna" value="TEST_3/TEST_3.fna"/> | |
| 349 <output name="annotation_ffn" value="TEST_3/TEST_3.ffn"/> | |
| 350 <output name="annotation_faa" value="TEST_3/TEST_3.faa"/> | |
| 351 <output name="annotation_json" value="TEST_3/TEST_3.json" lines_diff="4"/> | |
| 352 </test> | 245 </test> |
| 353 <test expect_num_outputs="12"> <!-- TEST_4 annotations --> | 246 <test expect_num_outputs="4"> <!-- TEST_2 another input, add organism info some annotations and skip 2 steps --> |
| 354 <section name="input_option" > | 247 <section name="input_option" > |
| 355 <param name="db_select" value="test-db-bakta"/> | 248 <param name="bakta_db_select" value="V0.1_2022-08-29"/> |
| 249 <param name="amrfinder_db_select" value="V3.6-2020-03-20.1"/> | |
| 356 <param name="input_file" value="NC_002127.1.fna"/> | 250 <param name="input_file" value="NC_002127.1.fna"/> |
| 251 <param name="min_contig_length" value="250"/> | |
| 252 </section> | |
| 253 <section name="organism"> | |
| 254 <param name="genus" value="Escherichia"/> | |
| 255 <param name="species" value="coli O157:H7"/> | |
| 256 <param name="strain" value="Sakai"/> | |
| 257 <param name="plasmid" value="pOSAK1"/> | |
| 357 </section> | 258 </section> |
| 358 <section name="annotation"> | 259 <section name="annotation"> |
| 359 <param name="complete" value="true"/> | 260 <param name="--gram" value="-"/> |
| 360 <param name="translation_table" value="4"/> | 261 <param name="keep_contig_headers" value="true"/> |
| 361 <param name="prodigal" value="prodigal.tf"/> | 262 </section> |
| 362 <param name="replicons" value="replicons.tsv"/> | 263 <section name="workflow"> |
| 363 <param name="compliant" value="true"/> | 264 <param name="skip_analysis" value="--skip-trna,--skip-tmrna"/> |
| 364 <param name="proteins" value="user-proteins.faa"/> | 265 </section> |
| 365 </section> | 266 <output name="annotation_tsv" value="TEST_2/TEST_2.tsv" lines_diff="4"> |
| 366 <output name="logfile" value="TEST_4/TEST_4.log" lines_diff="4"> | 267 <assert_contents> |
| 367 <assert_contents> | 268 <has_text_matching expression="IHHALP_00005"/> |
| 368 <has_text_matching expression="potential: 16"/> | 269 </assert_contents> |
| 369 </assert_contents> | 270 </output> |
| 370 </output> | 271 <output name="annotation_gff3" value="TEST_2/TEST_2.gff3" lines_diff="4"> |
| 371 <output name="annotation_tsv" value="TEST_4/TEST_4.tsv" lines_diff="2"/> | 272 <assert_contents> |
| 372 <output name="annotation_gff3" value="TEST_4/TEST_4.gff3" lines_diff="2"> | 273 <has_text_matching expression="ID=NC_002127.1;Name=NC_002127.1;Is_circular=true"/> |
| 373 <assert_contents> | 274 </assert_contents> |
| 374 <has_text_matching expression="ID=IHHALP_00005_gene;locus_tag=IHHALP_00005"/> | 275 </output> |
| 375 </assert_contents> | 276 <output name="annotation_ffn" value="TEST_2/TEST_2.ffn"/> |
| 376 </output> | 277 <output name="annotation_plot"> |
| 377 <output name="annotation_gbff" value="TEST_4/TEST_4.gbff" lines_diff="4"> | 278 <assert_contents> |
| 378 <assert_contents> | 279 <has_size value="418991" delta="1000"/> |
| 379 <has_text_matching expression="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA"/> | |
| 380 </assert_contents> | |
| 381 </output> | |
| 382 <output name="annotation_embl" value="TEST_4/TEST_4.embl" lines_diff="4"> | |
| 383 <assert_contents> | |
| 384 <has_text_matching expression="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRA"/> | |
| 385 </assert_contents> | |
| 386 </output> | |
| 387 <output name="annotation_fna" value="TEST_4/TEST_4.fna"/> | |
| 388 <output name="annotation_ffn" value="TEST_4/TEST_4.ffn"/> | |
| 389 <output name="annotation_faa" value="TEST_4/TEST_4.faa"/> | |
| 390 <output name="hypotheticals_tsv" value="TEST_4/TEST_4.hypotheticals.tsv"/> | |
| 391 <output name="hypotheticals_faa" value="TEST_4/TEST_4.hypotheticals.faa"/> | |
| 392 <output name="summary_txt" value="TEST_4/TEST_4.txt"> | |
| 393 <assert_contents> | |
| 394 <has_text_matching expression="GC: 45.2"/> | |
| 395 </assert_contents> | |
| 396 </output> | |
| 397 <output name="annotation_json" value="TEST_4/TEST_4.json" lines_diff="4"> | |
| 398 <assert_contents> | |
| 399 <has_text_matching expression="0.4518796992481203"/> | |
| 400 </assert_contents> | 280 </assert_contents> |
| 401 </output> | 281 </output> |
| 402 </test> | 282 </test> |
| 403 <test expect_num_outputs="2"> <!-- TEST_5 skip all steps and keep only the logfile and summary --> | 283 <test expect_num_outputs="4"> <!-- TEST_3 test all skip steps --> |
| 404 <section name="input_option" > | 284 <section name="input_option" > |
| 405 <param name="db_select" value="test-db-bakta"/> | 285 <param name="bakta_db_select" value="V0.1_2022-08-29"/> |
| 286 <param name="amrfinder_db_select" value="V3.6-2020-03-20.1"/> | |
| 406 <param name="input_file" value="NC_002127.1.fna"/> | 287 <param name="input_file" value="NC_002127.1.fna"/> |
| 407 </section> | 288 <param name="min_contig_length" value="350"/> |
| 408 <section name="annotation"> | |
| 409 <param name="complete" value="true"/> | |
| 410 <param name="translation_table" value="4"/> | |
| 411 </section> | 289 </section> |
| 412 <section name="workflow"> | 290 <section name="workflow"> |
| 413 <param name="skip_analysis" value="skip_trna,skip_tmrna,skip_rrna,skip_ncrna,skip_ncrna_region,skip_crispr,skip_cds,skip_sorf,skip_gap,skip_ori"/> | 291 <param name="skip_analysis" value="--skip-trna,--skip-tmrna,--skip-rrna,--skip-ncrna,--skip-ncrna-region,--skip-crispr,--skip-cds,--skip-sorf,--skip-gap,--skip-ori"/> |
| 414 </section> | 292 </section> |
| 415 <section name="output_files"> | 293 <output name="annotation_tsv" value="TEST_3/TEST_3.tsv" lines_diff="4"/> |
| 416 <param name="output_selection" value="log_txt,sum_txt"/> | 294 <output name="annotation_gff3" value="TEST_3/TEST_3.gff3" lines_diff="4"/> |
| 417 </section> | 295 <output name="annotation_ffn" value="TEST_3/TEST_3.ffn"/> |
| 418 <output name="logfile" value="TEST_5/TEST_5.log" lines_diff="4"/> | 296 <output name="annotation_plot"> |
| 419 <output name="summary_txt" value="TEST_5/TEST_5.txt" lines_diff="4"/> | 297 <assert_contents> |
| 420 </test> | 298 <has_size value="418399" delta="1000"/> |
| 299 </assert_contents> | |
| 300 </output> | |
| 301 </test> | |
| 302 <test expect_num_outputs="4"> <!-- TEST_4 annotations --> | |
| 303 <section name="input_option" > | |
| 304 <param name="bakta_db_select" value="V0.1_2022-08-29"/> | |
| 305 <param name="amrfinder_db_select" value="V3.6-2020-03-20.1"/> | |
| 306 <param name="input_file" value="NC_002127.1.fna"/> | |
| 307 </section> | |
| 308 <section name="annotation"> | |
| 309 <param name="complete" value="true"/> | |
| 310 <param name="prodigal" value="prodigal.tf"/> | |
| 311 <param name="translation_table" value="4"/> | |
| 312 <param name="replicons" value="replicons.tsv"/> | |
| 313 <param name="compliant" value="true"/> | |
| 314 <param name="proteins" value="user-proteins.faa"/> | |
| 315 </section> | |
| 316 <output name="annotation_tsv" value="TEST_4/TEST_4.tsv" lines_diff="4"/> | |
| 317 <output name="annotation_gff3" value="TEST_4/TEST_4.gff3" lines_diff="4"/> | |
| 318 <output name="annotation_ffn" value="TEST_4/TEST_4.ffn"/> | |
| 319 <output name="annotation_plot"> | |
| 320 <assert_contents> | |
| 321 <has_size value="418399" delta="1000"/> | |
| 322 </assert_contents> | |
| 323 </output> | |
| 324 </test> | |
| 325 <test expect_num_outputs="2"> <!-- TEST_5 skip all steps and keep only the logfile and summary --> | |
| 326 <section name="input_option" > | |
| 327 <param name="bakta_db_select" value="V0.1_2022-08-29"/> | |
| 328 <param name="amrfinder_db_select" value="V3.6-2020-03-20.1"/> | |
| 329 <param name="input_file" value="NC_002127.1.fna"/> | |
| 330 </section> | |
| 331 <section name="annotation"> | |
| 332 <param name="complete" value="true"/> | |
| 333 <param name="translation_table" value="4"/> | |
| 334 </section> | |
| 335 <section name="workflow"> | |
| 336 <param name="skip_analysis" value="--skip-trna,--skip-tmrna,--skip-rrna,--skip-ncrna,--skip-ncrna-region,--skip-crispr,--skip-cds,--skip-sorf,--skip-gap,--skip-ori"/> | |
| 337 </section> | |
| 338 <section name="output_files"> | |
| 339 <param name="output_selection" value="log_txt,sum_txt"/> | |
| 340 </section> | |
| 341 <output name="logfile" value="TEST_5/TEST_5.log" lines_diff="6"/> | |
| 342 <output name="summary_txt" value="TEST_5/TEST_5.txt" lines_diff="4"/> | |
| 343 </test> | |
| 421 </tests> | 344 </tests> |
| 422 <help><