Mercurial > repos > galaxyp > unipept
diff unipept.xml @ 4:1137ffa5e479 draft
"planemo upload for repository http://unipept.ugent.be/apidocs commit b6707ea113b2a89b0bb8072dfcc9ceeef4a1b708"
| author | galaxyp |
|---|---|
| date | Tue, 06 Apr 2021 16:13:31 +0000 |
| parents | dca8a1fe0bf3 |
| children | 42bc03ed02f6 |
line wrap: on
line diff
--- a/unipept.xml Mon Jun 01 21:17:46 2020 +0000 +++ b/unipept.xml Tue Apr 06 16:13:31 2021 +0000 @@ -1,4 +1,4 @@ -<tool id="unipept" name="Unipept" version="4.3.0"> +<tool id="unipept" name="Unipept" version="4.5.0"> <description>retrieve taxonomy for peptides</description> <macros> <xml name="equate_il"> @@ -76,6 +76,10 @@ #elif str($peptide_src.fmt) == 'pepxml': --pepxml="$peptide_src.input_pepxml" #end if + --peptide_match $peptide_match + #if $peptide_match == 'report' and $unmatched_aa != 'default': + --unmatched_aa $unmatched_aa + #end if #if 'json' in str($selected_outputs).split(',') and str($unipept.api) in ['pept2lca', 'pept2taxa', 'peptinfo']: --json $output_json #end if @@ -201,6 +205,16 @@ <param name="input_pepxml" type="data" format="pepxml" label="mzIndetML Input" /> </when> </conditional> + <param name="peptide_match" type="select" label="Match input peptides by"> + <option value="full">Match to the full input peptide</option> + <option value="best" selected="true">Best match to tryptic parts of the input peptide</option> + <option value="report">Best match to tryptic parts, add tryptic_match column</option> + </param> + <param name="unmatched_aa" type="select" label="Show tryptic_match as:"> + <option value="default">List of matched tryptic parts</option> + <option value=".">peptide with unmatched AAs as .</option> + <option value="x">peptide with unmatched AAs as x</option> + </param> <param name="selected_outputs" type="select" multiple="true" display="checkboxes" label="Choose outputs"> <option value="tsv" selected="true">Tabular with one line per peptide</option> <option value="csv">Comma Separated Values (.csv) with one line per peptide</option> @@ -272,6 +286,7 @@ </data> </outputs> <tests> + <!-- Test-1 --> <test> <param name="api" value="pept2lca"/> <param name="fmt" value="tabular"/> @@ -291,6 +306,7 @@ </assert_contents> </output> </test> + <!-- Test-2 --> <test> <param name="api" value="pept2lca"/> <param name="fmt" value="fasta"/> @@ -299,8 +315,6 @@ <param name="extra" value="True"/> <param name="names" value="True"/> <param name="selected_outputs" value="json,tsv"/> -<!-- ---> <output name="output_json"> <assert_contents> <has_text text="VMDVNDHKPEFYNCSLPACTFTPEEAQVNFTGYVDEHASPHIPIDDLTMVVYDPDKGSNGTFLLSLGGPDAEAFSVSPERAAGSASVQVLVRVSALVDYERQTAMAV" /> @@ -313,6 +327,7 @@ </assert_contents> </output> </test> + <!-- Test-3 --> <test> <param name="api" value="pept2taxa"/> <param name="fmt" value="fasta"/> @@ -328,6 +343,7 @@ </assert_contents> </output> </test> + <!-- Test-4 --> <test> <param name="api" value="pept2funct"/> <param name="fmt" value="tabular"/> @@ -359,6 +375,74 @@ </assert_contents> </output> </test> + <!-- Test-5 --> + <test> + <param name="api" value="pept2funct"/> + <param name="fmt" value="tabular"/> + <param name="input_tsv" value="input.tsv"/> + <param name="column" value="2"/> + <param name="extra" value="True"/> + <param name="names" value="True"/> + <param name="peptide_match" value="full"/> + <param name="selected_outputs" value="tsv,ec_tsv,go_tsv,ipr_tsv,unmatched"/> + <output name="output_tsv"> + <assert_contents> + <has_text text="GO:0004802" /> + <has_text text="2.2.1.1" /> + <has_text text="IPR005475" /> + <has_text_matching expression="FAPLLEEYKAEDWVQK\t0" /> + </assert_contents> + </output> + <output name="output_ec_tsv"> + <assert_contents> + <has_text text="2.2.1.1" /> + </assert_contents> + </output> + <output name="output_go_tsv"> + <assert_contents> + <has_text text="GO:0004802" /> + </assert_contents> + </output> + <output name="output_ipr_tsv"> + <assert_contents> + <has_text text="IPR005475" /> + </assert_contents> + </output> + </test> + <!-- Test-6 --> + <test> + <param name="api" value="pept2funct"/> + <param name="fmt" value="tabular"/> + <param name="input_tsv" value="input.tsv"/> + <param name="column" value="2"/> + <param name="extra" value="True"/> + <param name="names" value="True"/> + <param name="peptide_match" value="report"/> + <param name="selected_outputs" value="tsv,ec_tsv,go_tsv,ipr_tsv,unmatched"/> + <output name="output_tsv"> + <assert_contents> + <has_text text="GO:0004802" /> + <has_text text="2.2.1.1" /> + <has_text text="IPR005475" /> + <has_text_matching expression="FAPLLEEYKAEDWVQK\tAEDWVQK\t1" /> + </assert_contents> + </output> + <output name="output_ec_tsv"> + <assert_contents> + <has_text text="2.2.1.1" /> + </assert_contents> + </output> + <output name="output_go_tsv"> + <assert_contents> + <has_text text="GO:0004802" /> + </assert_contents> + </output> + <output name="output_ipr_tsv"> + <assert_contents> + <has_text text="IPR005475" /> + </assert_contents> + </output> + </test> </tests> <help><