Mercurial > repos > galaxyp > openms_idposteriorerrorprobability
comparison test-data/MetaProSIP_1_input.fasta @ 12:e0bff01d89c0 draft
planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/openms commit f608f41d45664d04d3124c6ebc791bf8a566b3c5
| author | galaxyp | 
|---|---|
| date | Wed, 15 May 2019 06:58:55 -0400 | 
| parents | |
| children | 
   comparison
  equal
  deleted
  inserted
  replaced
| 11:aa76d3d3e751 | 12:e0bff01d89c0 | 
|---|---|
| 1 >contig23640_802236 length=2326 numreads=28 strand:-1 frame:0 orf_location:136:990 | |
| 2 GGIPNEENWNFGSSDGSGLPVRGSGQRRDVLGRLCRRNFTSSIGQSVNVRDVEASGFAGG | |
| 3 MSRYHFKYGGAVDPTVLGGVKLGTWFVKEGFAGWSGYPDWCKYFGFYTDFSYHRFYTRDN | |
| 4 RISGTDFFAAYGGGSAALGDVGFMKTEGMVATWAFMLAARYGFFQDSEVPFGRLQPYVAV | |
| 5 GPAIMFSSMKPKIWTQFNEPNVGFPNPDLVYSPGNQSSTDLGLAVDTGIRYMCLKNVSLD | |
| 6 ISFKYRYAQPHYNFSGQDGSVMVPAHMSLSPALNLYSFQAGVAYHF | 
