Mercurial > repos > galaxyp > openms_iddecoyprobability
comparison test-data/MetaProSIP_1_input.fasta @ 12:6b42552b3350 draft default tip
planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/openms commit f608f41d45664d04d3124c6ebc791bf8a566b3c5
| author | galaxyp |
|---|---|
| date | Wed, 15 May 2019 05:32:48 -0400 |
| parents | |
| children |
comparison
equal
deleted
inserted
replaced
| 11:74ad806c5780 | 12:6b42552b3350 |
|---|---|
| 1 >contig23640_802236 length=2326 numreads=28 strand:-1 frame:0 orf_location:136:990 | |
| 2 GGIPNEENWNFGSSDGSGLPVRGSGQRRDVLGRLCRRNFTSSIGQSVNVRDVEASGFAGG | |
| 3 MSRYHFKYGGAVDPTVLGGVKLGTWFVKEGFAGWSGYPDWCKYFGFYTDFSYHRFYTRDN | |
| 4 RISGTDFFAAYGGGSAALGDVGFMKTEGMVATWAFMLAARYGFFQDSEVPFGRLQPYVAV | |
| 5 GPAIMFSSMKPKIWTQFNEPNVGFPNPDLVYSPGNQSSTDLGLAVDTGIRYMCLKNVSLD | |
| 6 ISFKYRYAQPHYNFSGQDGSVMVPAHMSLSPALNLYSFQAGVAYHF |
