Mercurial > repos > devteam > emboss_5
diff test-data/emboss_sixpack_out.fasta @ 14:27c43fb015f0 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/emboss_5 commit 9844cae766e7471d9fa6b2e8356e5194e77f6753
| author | iuc |
|---|---|
| date | Fri, 22 Jun 2018 03:24:29 -0400 |
| parents | |
| children |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/emboss_sixpack_out.fasta Fri Jun 22 03:24:29 2018 -0400 @@ -0,0 +1,53 @@ +>Sequence_1_ORF1 Translation of Sequence in frame 1, ORF 1, threshold 1, 17aa +VRCLKYLLLSLHRPQFS +>Sequence_1_ORF2 Translation of Sequence in frame 1, ORF 2, threshold 1, 5aa +WLYTD +>Sequence_1_ORF3 Translation of Sequence in frame 1, ORF 3, threshold 1, 6aa +KFLCKH +>Sequence_1_ORF4 Translation of Sequence in frame 1, ORF 4, threshold 1, 12aa +LKAVGLECYRFV +>Sequence_1_ORF5 Translation of Sequence in frame 1, ORF 5, threshold 1, 33aa +LSASLALIKGSFSLLWKTLWKNTTSTSLSPLVC +>Sequence_1_ORF6 Translation of Sequence in frame 1, ORF 6, threshold 1, 25aa +LLDTVVIPFATPRNYLYELFSLYYM +>Sequence_1_ORF7 Translation of Sequence in frame 1, ORF 7, threshold 1, 3aa +VRL +>Sequence_1_ORF8 Translation of Sequence in frame 1, ORF 8, threshold 1, 40aa +SSFSKSFTVFDLNVHVLRLFWIICGQFNLRCFFLKYLFMV +>Sequence_1_ORF9 Translation of Sequence in frame 1, ORF 9, threshold 1, 29aa +FLVCTCSGASSLFTLFVYSSSFIFSMILI +>Sequence_2_ORF1 Translation of Sequence in frame 2, ORF 1, threshold 1, 3aa +FDA +>Sequence_2_ORF2 Translation of Sequence in frame 2, ORF 2, threshold 1, 27aa +NTFFCPYTDHSFPNGFTPTRNSCASTN +>Sequence_2_ORF3 Translation of Sequence in frame 2, ORF 3, threshold 1, 4aa +KRLA +>Sequence_2_ORF4 Translation of Sequence in frame 2, ORF 4, threshold 1, 7aa +SVTGLYS +>Sequence_2_ORF5 Translation of Sequence in frame 2, ORF 5, threshold 1, 5aa +ARLLP +>Sequence_2_ORF6 Translation of Sequence in frame 2, ORF 6, threshold 1, 32aa +SKVHFLYFGRRCGRIQQVRVSPPWFADYWIQL +>Sequence_2_ORF7 Translation of Sequence in frame 2, ORF 7, threshold 1, 46aa +YPSQHRVTIYMNYFPFIICSRFVFNLPLASLLLFSTSMFMFLGCFG +>Sequence_2_ORF8 Translation of Sequence in frame 2, ORF 8, threshold 1, 11aa +YAVSLIFVVSS +>Sequence_2_ORF9 Translation of Sequence in frame 2, ORF 9, threshold 1, 32aa +NIYSWFNFWFVLVQGPVHYLLCLYTAVLLFLV +>Sequence_2_ORF10 Translation of Sequence in frame 2, ORF 10, threshold 1, 1aa +F +>Sequence_3_ORF1 Translation of Sequence in frame 3, ORF 1, threshold 1, 90aa +SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAERVSCPDQRFIFSTLE +DVVEEYNKYESLPPGLLITGYSCNTLRNTA +>Sequence_3_ORF2 Translation of Sequence in frame 3, ORF 2, threshold 1, 3aa +LSI +>Sequence_3_ORF3 Translation of Sequence in frame 3, ORF 3, threshold 1, 16aa +IIFPLLYVVGSSLIFL +>Sequence_3_ORF4 Translation of Sequence in frame 3, ORF 4, threshold 1, 13aa +QVFYCFRPQCSCS +>Sequence_3_ORF5 Translation of Sequence in frame 3, ORF 5, threshold 1, 9aa +VVLDNMRSV +>Sequence_3_ORF6 Translation of Sequence in frame 3, ORF 6, threshold 1, 37aa +SSLFLLKIFIHGLIFGLYLFRGQFIIYSVCIQQFFYF +>Sequence_3_ORF7 Translation of Sequence in frame 3, ORF 7, threshold 1, 8aa +YDFNLKQF
